dinaciclib [Ligand Id: 7379] activity data from GtoPdb and ChEMBL

Click here for a description of the charts and data table

Please tell us if you are using this feature and what you think!

ChEMBL ligand: CHEMBL2103840 (Dinaciclib, Mk-7965, SCH 727965, SCH-727965, SCH727965)
Created with Highcharts 10.3.3ValuesChart context menu26S protease regulatory subunit 6BpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuActin-related protein 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuActin-related protein 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • activin A receptor type 1/Activin receptor type-1 in Human [ChEMBL: CHEMBL5903] [GtoPdb: 1785] [UniProtKB: Q04771]
Created with Highcharts 10.3.3ValuesChart context menuActivin receptor type-1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • activin A receptor type 1B/Activin receptor type-1B in Human [ChEMBL: CHEMBL5310] [GtoPdb: 1787] [UniProtKB: P36896]
Created with Highcharts 10.3.3ValuesChart context menuActivin receptor type-1BpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • activin A receptor type 2B/Activin receptor type-2B in Human [ChEMBL: CHEMBL5466] [GtoPdb: 1792] [UniProtKB: Q13705]
Created with Highcharts 10.3.3ValuesChart context menuActivin receptor type-2BpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuAcyl-CoA dehydrogenase family member 10pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuAcyl-CoA dehydrogenase family member 11pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • AP2 associated kinase 1/Adaptor-associated kinase in Human [ChEMBL: CHEMBL3830] [GtoPdb: 1921] [UniProtKB: Q2M2I8]
Created with Highcharts 10.3.3ValuesChart context menuAdaptor-associated kinasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuAdenine phosphoribosyltransferasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuAdenosine kinasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuAdenylate kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Mitochondrial adenine nucleotide translocator 2/ADP/ATP translocase 2 in Human [ChEMBL: CHEMBL3709670] [GtoPdb: 1063] [UniProtKB: P05141]
Created with Highcharts 10.3.3ValuesChart context menuADP/ATP translocase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Mitochondrial adenine nucleotide translocator 3/ADP/ATP translocase 3 in Human [ChEMBL: CHEMBL4105854] [GtoPdb: 1064] [UniProtKB: P12236]
Created with Highcharts 10.3.3ValuesChart context menuADP/ATP translocase 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • AKR1C3/Aldo-keto-reductase family 1 member C3 in Human [ChEMBL: CHEMBL4681] [GtoPdb: 1382] [UniProtKB: P42330]
Created with Highcharts 10.3.3ValuesChart context menuAldo-keto-reductase family 1 member C3pKd HumanpKi HumanpIC50 HumanpEC50 Human02468Highcharts.com
  • protein kinase AMP-activated catalytic subunit alpha 1/AMP-activated protein kinase, alpha-1 subunit in Human [ChEMBL: CHEMBL4045] [GtoPdb: 1541] [UniProtKB: Q13131]
Created with Highcharts 10.3.3ValuesChart context menuAMP-activated protein kinase, alpha-1 subunitpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase AMP-activated non-catalytic subunit gamma 1/AMP-activated protein kinase, gamma-1 subunit in Human [ChEMBL: CHEMBL2393] [GtoPdb: 1545] [UniProtKB: P54619]
Created with Highcharts 10.3.3ValuesChart context menuAMP-activated protein kinase, gamma-1 subunitpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase AMP-activated non-catalytic subunit gamma 2/AMP-activated protein kinase, gamma-2 subunit in Human [ChEMBL: CHEMBL2453] [GtoPdb: 1546] [UniProtKB: Q9UGJ0]
Created with Highcharts 10.3.3ValuesChart context menuAMP-activated protein kinase, gamma-2 subunitpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuATP-dependent RNA helicase DDX1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • ATP-dependent RNA helicase DDX3X in Human [ChEMBL: CHEMBL5553] [UniProtKB: O00571]
Created with Highcharts 10.3.3ValuesChart context menuATP-dependent RNA helicase DDX3XpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuATP-dependent RNA helicase DDX42pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • BMP2 inducible kinase/BMP-2-inducible protein kinase in Human [ChEMBL: CHEMBL4522] [GtoPdb: 1941] [UniProtKB: Q9NSY1]
Created with Highcharts 10.3.3ValuesChart context menuBMP-2-inducible protein kinasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • bone morphogenetic protein receptor type IA/Bone morphogenetic protein receptor type-1A in Human [ChEMBL: CHEMBL5275] [GtoPdb: 1786] [UniProtKB: P36894]
Created with Highcharts 10.3.3ValuesChart context menuBone morphogenetic protein receptor type-1ApKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • bone morphogenetic protein receptor type IB/Bone morphogenetic protein receptor type-1B in Human [ChEMBL: CHEMBL5476] [GtoPdb: 1789] [UniProtKB: O00238]
Created with Highcharts 10.3.3ValuesChart context menuBone morphogenetic protein receptor type-1BpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • bone morphogenetic protein receptor type 2/Bone morphogenetic protein receptor type-2 in Human [ChEMBL: CHEMBL5467] [GtoPdb: 1794] [UniProtKB: Q13873]
Created with Highcharts 10.3.3ValuesChart context menuBone morphogenetic protein receptor type-2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Brain glycogen phosphorylase in Human [ChEMBL: CHEMBL3856] [UniProtKB: P11216]
Created with Highcharts 10.3.3ValuesChart context menuBrain glycogen phosphorylasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • BCR activator of RhoGEF and GTPase/Breakpoint cluster region protein in Human [ChEMBL: CHEMBL5146] [GtoPdb: 2755] [UniProtKB: P11274]
Created with Highcharts 10.3.3ValuesChart context menuBreakpoint cluster region proteinpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • bromodomain containing 4/Bromodomain-containing protein 4 in Human [ChEMBL: CHEMBL1163125] [GtoPdb: 1945] [UniProtKB: O60885]
Created with Highcharts 10.3.3ValuesChart context menuBromodomain-containing protein 4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • bromodomain testis associated/Bromodomain testis-specific protein in Human [ChEMBL: CHEMBL1795185] [GtoPdb: 2729] [UniProtKB: Q58F21]
Created with Highcharts 10.3.3ValuesChart context menuBromodomain testis-specific proteinpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • calcium/calmodulin-dependent protein kinase II delta subunit/CaM kinase II delta in Human [ChEMBL: CHEMBL2801] [GtoPdb: 1558] [UniProtKB: Q13557]
Created with Highcharts 10.3.3ValuesChart context menuCaM kinase II deltapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • calcium/calmodulin-dependent protein kinase II gamma subunit/CaM kinase II gamma in Human [ChEMBL: CHEMBL3829] [GtoPdb: 1557] [UniProtKB: Q13555]
Created with Highcharts 10.3.3ValuesChart context menuCaM kinase II gammapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • calcium/calmodulin dependent protein kinase IV/CaM kinase IV in Human [ChEMBL: CHEMBL2494] [GtoPdb: 1955] [UniProtKB: Q16566]
Created with Highcharts 10.3.3ValuesChart context menuCaM kinase IVpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • calcium/calmodulin dependent protein kinase kinase 2/CaM-kinase kinase beta in Human [ChEMBL: CHEMBL5284] [GtoPdb: 1957] [UniProtKB: Q96RR4]
Created with Highcharts 10.3.3ValuesChart context menuCaM-kinase kinase betapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase, cAMP-dependent, catalytic, alpha subunit/cAMP-dependent protein kinase alpha-catalytic subunit in Human [ChEMBL: CHEMBL4101] [GtoPdb: 1476] [UniProtKB: P17612]
Created with Highcharts 10.3.3ValuesChart context menucAMP-dependent protein kinase alpha-catalytic subunitpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase, cAMP-dependent, catalytic, beta subunit/cAMP-dependent protein kinase beta-1 catalytic subunit in Human [ChEMBL: CHEMBL2918] [GtoPdb: 1477] [UniProtKB: P22694]
Created with Highcharts 10.3.3ValuesChart context menucAMP-dependent protein kinase beta-1 catalytic subunitpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase, cAMP-dependent, catalytic, gamma subunit/cAMP-dependent protein kinase, gamma catalytic subunit in Human [ChEMBL: CHEMBL2743] [GtoPdb: 1478] [UniProtKB: P22612]
Created with Highcharts 10.3.3ValuesChart context menucAMP-dependent protein kinase, gamma catalytic subunitpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase, cAMP-dependent, regulatory, type II, alpha subunit/cAMP-dependent protein kinase type II-alpha regulatory subunit in Human [ChEMBL: CHEMBL2221] [GtoPdb: 1474] [UniProtKB: P13861]
Created with Highcharts 10.3.3ValuesChart context menucAMP-dependent protein kinase type II-alpha regulatory subunitpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • casein kinase 1 alpha 1/Casein kinase I alpha in Human [ChEMBL: CHEMBL2793] [GtoPdb: 1995] [UniProtKB: P48729]
Created with Highcharts 10.3.3ValuesChart context menuCasein kinase I alphapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • casein kinase 1 delta/Casein kinase I delta in Human [ChEMBL: CHEMBL2828] [GtoPdb: 1997] [UniProtKB: P48730]
Created with Highcharts 10.3.3ValuesChart context menuCasein kinase I deltapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • casein kinase 1 epsilon/Casein kinase I epsilon in Human [ChEMBL: CHEMBL4937] [GtoPdb: 1998] [UniProtKB: P49674]
Created with Highcharts 10.3.3ValuesChart context menuCasein kinase I epsilonpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • casein kinase 1 gamma 1/Casein kinase I gamma 1 in Human [ChEMBL: CHEMBL2426] [GtoPdb: 1999] [UniProtKB: Q9HCP0]
Created with Highcharts 10.3.3ValuesChart context menuCasein kinase I gamma 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • casein kinase 1 gamma 2/Casein kinase I gamma 2 in Human [ChEMBL: CHEMBL2543] [GtoPdb: 2000] [UniProtKB: P78368]
Created with Highcharts 10.3.3ValuesChart context menuCasein kinase I gamma 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • casein kinase 2, alpha prime polypeptide subunit/Casein kinase II alpha (prime) in Human [ChEMBL: CHEMBL4070] [GtoPdb: 1550] [UniProtKB: P19784]
Created with Highcharts 10.3.3ValuesChart context menuCasein kinase II alpha (prime)pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • casein kinase 1 gamma 3/Casein kinase I isoform gamma-3 in Human [ChEMBL: CHEMBL5084] [GtoPdb: 2001] [UniProtKB: Q9Y6M4]
Created with Highcharts 10.3.3ValuesChart context menuCasein kinase I isoform gamma-3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuCDK12/Cyclin KpKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuCDK2/Cyclin A1pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuCDK2/Cyclin A2pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuCDK7/Cyclin H/MNAT1pKd HumanpKi HumanpIC50 HumanpEC50 Human02468Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuCDK9/Cyclin TpKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuCDK9/cyclin T1pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
  • cyclin dependent kinase 8/Cell division protein kinase 8 in Human [ChEMBL: CHEMBL5719] [GtoPdb: 1980] [UniProtKB: P49336]
Created with Highcharts 10.3.3ValuesChart context menuCell division protein kinase 8pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
  • Protein kinase G (PKG) 1/cGMP-dependent protein kinase 1 beta in Human [ChEMBL: CHEMBL4273] [GtoPdb: 1492] [UniProtKB: Q13976]
Created with Highcharts 10.3.3ValuesChart context menucGMP-dependent protein kinase 1 betapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • coenzyme Q8A/Chaperone activity of bc1 complex-like, mitochondrial in Human [ChEMBL: CHEMBL5550] [GtoPdb: 1927] [UniProtKB: Q8NI60]
Created with Highcharts 10.3.3ValuesChart context menuChaperone activity of bc1 complex-like, mitochondrialpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Choline-phosphate cytidylyltransferase A in Human [ChEMBL: CHEMBL4105855] [UniProtKB: P49585]
Created with Highcharts 10.3.3ValuesChart context menuCholine-phosphate cytidylyltransferase ApKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Chromodomain-helicase-DNA-binding protein 4 in Human [ChEMBL: CHEMBL4105742] [UniProtKB: Q14839]
Created with Highcharts 10.3.3ValuesChart context menuChromodomain-helicase-DNA-binding protein 4pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
  • citron rho-interacting serine/threonine kinase/Citron Rho-interacting kinase in Human [ChEMBL: CHEMBL5579] [GtoPdb: 1509] [UniProtKB: O14578]
Created with Highcharts 10.3.3ValuesChart context menuCitron Rho-interacting kinasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase 8/c-Jun N-terminal kinase 1 in Human [ChEMBL: CHEMBL2276] [GtoPdb: 1496] [UniProtKB: P45983]
Created with Highcharts 10.3.3ValuesChart context menuc-Jun N-terminal kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase 9/c-Jun N-terminal kinase 2 in Human [ChEMBL: CHEMBL4179] [GtoPdb: 1497] [UniProtKB: P45984]
Created with Highcharts 10.3.3ValuesChart context menuc-Jun N-terminal kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase 10/c-Jun N-terminal kinase 3 in Human [ChEMBL: CHEMBL2637] [GtoPdb: 1498] [UniProtKB: P53779]
Created with Highcharts 10.3.3ValuesChart context menuc-Jun N-terminal kinase 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • cyclin dependent kinase 1/Cyclin-dependent kinase 1 in Human [ChEMBL: CHEMBL308] [GtoPdb: 1961] [UniProtKB: P06493]
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
  • cyclin dependent kinase 12/Cyclin-dependent kinase 12 in Human [ChEMBL: CHEMBL3559692] [GtoPdb: 1965] [UniProtKB: Q9NYV4]
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 12pKd HumanpKi HumanpIC50 HumanpEC50 Human02468Highcharts.com
  • cyclin dependent kinase 13/Cyclin-dependent kinase 13 in Human [ChEMBL: CHEMBL1795192] [GtoPdb: 1966] [UniProtKB: Q14004]
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 13pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 13/Cyclin-KpKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 1/cyclin BpKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 1/cyclin B1pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
  • cyclin dependent kinase 2/Cyclin-dependent kinase 2 in Human [ChEMBL: CHEMBL301] [GtoPdb: 1973] [UniProtKB: P24941]
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 2/cyclin EpKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 2/cyclin E1pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
  • cyclin dependent kinase 2/Cyclin-dependent kinase 2/G1/S-specific cyclin-D1 in Human [ChEMBL: CHEMBL3885552] [GtoPdb: 1973] [UniProtKB: P24385P24941]
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 2/G1/S-specific cyclin-D1pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
  • cyclin dependent kinase 3/Cyclin-dependent kinase 3 in Human [ChEMBL: CHEMBL4442] [GtoPdb: 1975] [UniProtKB: Q00526]
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • cyclin dependent kinase 4/Cyclin-dependent kinase 4 in Human [ChEMBL: CHEMBL331] [GtoPdb: 1976] [UniProtKB: P11802]
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 4pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 4/cyclin D1pKd HumanpKi HumanpIC50 HumanpEC50 Human02468Highcharts.com
  • cyclin dependent kinase 5/Cyclin-dependent kinase 5 in Human [ChEMBL: CHEMBL4036] [GtoPdb: 1977] [UniProtKB: Q00535]
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 5pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
  • cyclin dependent kinase 5/Cyclin-dependent kinase 5/CDK5 activator 1 in Human [ChEMBL: CHEMBL1907600] [GtoPdb: 1977] [UniProtKB: Q00535Q15078]
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 5/CDK5 activator 1pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
  • cyclin dependent kinase 6/Cyclin-dependent kinase 6 in Human [ChEMBL: CHEMBL2508] [GtoPdb: 1978] [UniProtKB: Q00534]
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 6pKd HumanpKi HumanpIC50 HumanpEC50 Human02468Highcharts.com
  • cyclin dependent kinase 7/Cyclin-dependent kinase 7 in Human [ChEMBL: CHEMBL3055] [GtoPdb: 1979] [UniProtKB: P50613]
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 7pKd HumanpKi HumanpIC50 HumanpEC50 Human02468Highcharts.com
  • cyclin dependent kinase 9/Cyclin-dependent kinase 9 in Human [ChEMBL: CHEMBL3116] [GtoPdb: 1981] [UniProtKB: P50750]
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase 9pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
  • cyclin-dependent kinase like 5/Cyclin-dependent kinase-like 5 in Human [ChEMBL: CHEMBL1163112] [GtoPdb: 1986] [UniProtKB: O76039]
Created with Highcharts 10.3.3ValuesChart context menuCyclin-dependent kinase-like 5pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuCysteine--tRNA ligase, cytoplasmicpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Cytochrome c1, heme protein, mitochondrial in Human [ChEMBL: CHEMBL4105975] [UniProtKB: P08574]
Created with Highcharts 10.3.3ValuesChart context menuCytochrome c1, heme protein, mitochondrialpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menudCTP pyrophosphatase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuDelta(24)-sterol reductasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuDeoxycytidine kinasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • discoidin domain receptor tyrosine kinase 2/Discoidin domain-containing receptor 2 in Human [ChEMBL: CHEMBL5122] [GtoPdb: 1844] [UniProtKB: Q16832]
Created with Highcharts 10.3.3ValuesChart context menuDiscoidin domain-containing receptor 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuDnaJ homolog subfamily A member 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuDNA replication licensing factor MCM4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuDNA topoisomerase II alphapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuDNA topoisomerase II betapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase 1/Dual specificity mitogen-activated protein kinase kinase 1 in Human [ChEMBL: CHEMBL3587] [GtoPdb: 2062] [UniProtKB: Q02750]
Created with Highcharts 10.3.3ValuesChart context menuDual specificity mitogen-activated protein kinase kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase 2/Dual specificity mitogen-activated protein kinase kinase 2 in Human [ChEMBL: CHEMBL2964] [GtoPdb: 2063] [UniProtKB: P36507]
Created with Highcharts 10.3.3ValuesChart context menuDual specificity mitogen-activated protein kinase kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase 3/Dual specificity mitogen-activated protein kinase kinase 3 in Human [ChEMBL: CHEMBL2109] [GtoPdb: 2064] [UniProtKB: P46734]
Created with Highcharts 10.3.3ValuesChart context menuDual specificity mitogen-activated protein kinase kinase 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase 4/Dual specificity mitogen-activated protein kinase kinase 4 in Human [ChEMBL: CHEMBL2897] [GtoPdb: 2065] [UniProtKB: P45985]
Created with Highcharts 10.3.3ValuesChart context menuDual specificity mitogen-activated protein kinase kinase 4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase 5/Dual specificity mitogen-activated protein kinase kinase 5 in Human [ChEMBL: CHEMBL4948] [GtoPdb: 2066] [UniProtKB: Q13163]
Created with Highcharts 10.3.3ValuesChart context menuDual specificity mitogen-activated protein kinase kinase 5pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase 6/Dual specificity mitogen-activated protein kinase kinase 6 in Human [ChEMBL: CHEMBL2171] [GtoPdb: 2067] [UniProtKB: P52564]
Created with Highcharts 10.3.3ValuesChart context menuDual specificity mitogen-activated protein kinase kinase 6pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • CDC like kinase 1/Dual specificity protein kinase CLK1 in Human [ChEMBL: CHEMBL4224] [GtoPdb: 1990] [UniProtKB: P49759]
Created with Highcharts 10.3.3ValuesChart context menuDual specificity protein kinase CLK1pKd HumanpKi HumanpIC50 HumanpEC50 Human01234567Highcharts.com
  • CDC like kinase 2/Dual specificity protein kinase CLK2 in Human [ChEMBL: CHEMBL4225] [GtoPdb: 1991] [UniProtKB: P49760]
Created with Highcharts 10.3.3ValuesChart context menuDual specificity protein kinase CLK2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • CDC like kinase 4/Dual specificity protein kinase CLK4 in Human [ChEMBL: CHEMBL4203] [GtoPdb: 1993] [UniProtKB: Q9HAZ1]
Created with Highcharts 10.3.3ValuesChart context menuDual specificity protein kinase CLK4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • testis associated actin remodelling kinase 1/Dual specificity testis-specific protein kinase 1 in Human [ChEMBL: CHEMBL5604] [GtoPdb: 2239] [UniProtKB: Q15569]
Created with Highcharts 10.3.3ValuesChart context menuDual specificity testis-specific protein kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • testis associated actin remodelling kinase 2/Dual specificity testis-specific protein kinase 2 in Human [ChEMBL: CHEMBL2069163] [GtoPdb: 2240] [UniProtKB: Q96S53]
Created with Highcharts 10.3.3ValuesChart context menuDual specificity testis-specific protein kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • dual specificity tyrosine phosphorylation regulated kinase 1A/Dual-specificity tyrosine-phosphorylation regulated kinase 1A in Human [ChEMBL: CHEMBL2292] [GtoPdb: 2009] [UniProtKB: Q13627]
Created with Highcharts 10.3.3ValuesChart context menuDual-specificity tyrosine-phosphorylation regulated kinase 1ApKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Dynamin-like 120 kDa protein, mitochondrial in Human [ChEMBL: CHEMBL4105705] [UniProtKB: O60313]
Created with Highcharts 10.3.3ValuesChart context menuDynamin-like 120 kDa protein, mitochondrialpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Electron transfer flavoprotein subunit beta in Human [ChEMBL: CHEMBL4105744] [UniProtKB: P38117]
Created with Highcharts 10.3.3ValuesChart context menuElectron transfer flavoprotein subunit betapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuElongation factor Tu, mitochondrialpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • EPH receptor A1/Ephrin type-A receptor 1 in Human [ChEMBL: CHEMBL5810] [GtoPdb: 1821] [UniProtKB: P21709]
Created with Highcharts 10.3.3ValuesChart context menuEphrin type-A receptor 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • EPH receptor A2/Ephrin type-A receptor 2 in Human [ChEMBL: CHEMBL2068] [GtoPdb: 1822] [UniProtKB: P29317]
Created with Highcharts 10.3.3ValuesChart context menuEphrin type-A receptor 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • EPH receptor A4/Ephrin type-A receptor 4 in Human [ChEMBL: CHEMBL3988] [GtoPdb: 1824] [UniProtKB: P54764]
Created with Highcharts 10.3.3ValuesChart context menuEphrin type-A receptor 4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • EPH receptor A5/Ephrin type-A receptor 5 in Human [ChEMBL: CHEMBL3987] [GtoPdb: 1825] [UniProtKB: P54756]
Created with Highcharts 10.3.3ValuesChart context menuEphrin type-A receptor 5pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • EPH receptor A7/Ephrin type-A receptor 7 in Human [ChEMBL: CHEMBL4602] [GtoPdb: 1827] [UniProtKB: Q15375]
Created with Highcharts 10.3.3ValuesChart context menuEphrin type-A receptor 7pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • EPH receptor B2/Ephrin type-B receptor 2 in Human [ChEMBL: CHEMBL3290] [GtoPdb: 1831] [UniProtKB: P29323]
Created with Highcharts 10.3.3ValuesChart context menuEphrin type-B receptor 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • EPH receptor B3/Ephrin type-B receptor 3 in Human [ChEMBL: CHEMBL4901] [GtoPdb: 1832] [UniProtKB: P54753]
Created with Highcharts 10.3.3ValuesChart context menuEphrin type-B receptor 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • EPH receptor B4/Ephrin type-B receptor 4 in Human [ChEMBL: CHEMBL5147] [GtoPdb: 1833] [UniProtKB: P54760]
Created with Highcharts 10.3.3ValuesChart context menuEphrin type-B receptor 4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • EPH receptor B6/Ephrin type-B receptor 6 in Human [ChEMBL: CHEMBL5836] [GtoPdb: 1834] [UniProtKB: O15197]
Created with Highcharts 10.3.3ValuesChart context menuEphrin type-B receptor 6pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • epidermal growth factor receptor/Epidermal growth factor receptor erbB1 in Human [ChEMBL: CHEMBL203] [GtoPdb: 1797] [UniProtKB: P00533]
Created with Highcharts 10.3.3ValuesChart context menuEpidermal growth factor receptor erbB1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • discoidin domain receptor tyrosine kinase 1/Epithelial discoidin domain-containing receptor 1 in Human [ChEMBL: CHEMBL5319] [GtoPdb: 1843] [UniProtKB: Q08345]
Created with Highcharts 10.3.3ValuesChart context menuEpithelial discoidin domain-containing receptor 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • eukaryotic translation initiation factor 2 alpha kinase 1/Eukaryotic translation initiation factor 2-alpha kinase 1 in Human [ChEMBL: CHEMBL6029] [GtoPdb: 2015] [UniProtKB: Q9BQI3]
Created with Highcharts 10.3.3ValuesChart context menuEukaryotic translation initiation factor 2-alpha kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Eukaryotic translation initiation factor 5B in Human [ChEMBL: CHEMBL4105852] [UniProtKB: O60841]
Created with Highcharts 10.3.3ValuesChart context menuEukaryotic translation initiation factor 5BpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuExosome RNA helicase MTR4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuFerrochelatase, mitochondrialpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • fibroblast growth factor receptor 1/Fibroblast growth factor receptor 1 in Human [ChEMBL: CHEMBL3650] [GtoPdb: 1808] [UniProtKB: P11362]
Created with Highcharts 10.3.3ValuesChart context menuFibroblast growth factor receptor 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein tyrosine kinase 2/Focal adhesion kinase 1 in Human [ChEMBL: CHEMBL2695] [GtoPdb: 2180] [UniProtKB: Q05397]
Created with Highcharts 10.3.3ValuesChart context menuFocal adhesion kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • General transcription and DNA repair factor IIH helicase subunit XPD in Human [ChEMBL: CHEMBL4105743] [UniProtKB: P18074]
Created with Highcharts 10.3.3ValuesChart context menuGeneral transcription and DNA repair factor IIH helicase subunit XPDpKd HumanpKi HumanpIC50 HumanpEC50 Human01234567Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuGlycine--tRNA ligasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • glycogen synthase kinase 3 alpha/Glycogen synthase kinase-3 alpha in Human [ChEMBL: CHEMBL2850] [GtoPdb: 2029] [UniProtKB: P49840]
Created with Highcharts 10.3.3ValuesChart context menuGlycogen synthase kinase-3 alphapKd HumanpKi HumanpIC50 HumanpEC50 Human02468Highcharts.com
  • glycogen synthase kinase 3 beta/Glycogen synthase kinase-3 beta in Human [ChEMBL: CHEMBL262] [GtoPdb: 2030] [UniProtKB: P49841]
Created with Highcharts 10.3.3ValuesChart context menuGlycogen synthase kinase-3 betapKd HumanpKi HumanpIC50 HumanpEC50 Human02468Highcharts.com
  • beta adrenergic receptor kinase 1/G-protein coupled receptor kinase 2 in Human [ChEMBL: CHEMBL4079] [GtoPdb: 1466] [UniProtKB: P25098]
Created with Highcharts 10.3.3ValuesChart context menuG-protein coupled receptor kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • G protein-coupled receptor kinase 6 in Human [ChEMBL: CHEMBL6144] [GtoPdb: 1470] [UniProtKB: P43250]
Created with Highcharts 10.3.3ValuesChart context menuG protein-coupled receptor kinase 6pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuGTP-binding nuclear protein RanpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Guanine nucleotide-binding protein G(i) subunit alpha-2 in Human [ChEMBL: CHEMBL4105887] [UniProtKB: P04899]
Created with Highcharts 10.3.3ValuesChart context menuGuanine nucleotide-binding protein G(i) subunit alpha-2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuHeat shock factor protein 1pKd HumanpKi HumanpIC50 HumanpEC50 Human0246810Highcharts.com
  • Haem oxygenase 2/Heme oxygenase 2 in Human [ChEMBL: CHEMBL2546] [GtoPdb: 1442] [UniProtKB: P30519]
Created with Highcharts 10.3.3ValuesChart context menuHeme oxygenase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • MET proto-oncogene, receptor tyrosine kinase/Hepatocyte growth factor receptor in Human [ChEMBL: CHEMBL3717] [GtoPdb: 1815] [UniProtKB: P08581]
Created with Highcharts 10.3.3ValuesChart context menuHepatocyte growth factor receptorpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • inhibitor of nuclear factor kappa B kinase subunit epsilon/Inhibitor of nuclear factor kappa B kinase epsilon subunit in Human [ChEMBL: CHEMBL3529] [GtoPdb: 2040] [UniProtKB: Q14164]
Created with Highcharts 10.3.3ValuesChart context menuInhibitor of nuclear factor kappa B kinase epsilon subunitpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • inosine monophosphate dehydrogenase 2/Inosine-5`-monophosphate dehydrogenase 2 in Human [ChEMBL: CHEMBL2002] [GtoPdb: 2625] [UniProtKB: P12268]
Created with Highcharts 10.3.3ValuesChart context menuInosine-5`-monophosphate dehydrogenase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Insulin-like growth factor I receptor in Human [ChEMBL: CHEMBL1957] [GtoPdb: 1801] [UniProtKB: P08069]
Created with Highcharts 10.3.3ValuesChart context menuInsulin-like growth factor I receptorpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuInsulin receptorpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • interleukin 1 receptor associated kinase 1/Interleukin-1 receptor-associated kinase 1 in Human [ChEMBL: CHEMBL3357] [GtoPdb: 2042] [UniProtKB: P51617]
Created with Highcharts 10.3.3ValuesChart context menuInterleukin-1 receptor-associated kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • interleukin 1 receptor associated kinase 3/Interleukin-1 receptor-associated kinase 3 in Human [ChEMBL: CHEMBL5081] [GtoPdb: 2044] [UniProtKB: Q9Y616]
Created with Highcharts 10.3.3ValuesChart context menuInterleukin-1 receptor-associated kinase 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • interleukin 1 receptor associated kinase 4/Interleukin-1 receptor-associated kinase 4 in Human [ChEMBL: CHEMBL3778] [GtoPdb: 2045] [UniProtKB: Q9NWZ3]
Created with Highcharts 10.3.3ValuesChart context menuInterleukin-1 receptor-associated kinase 4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuIsoleucine--tRNA ligase, mitochondrialpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuLIM domain kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuLIM domain kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Liver glycogen phosphorylase in Human [ChEMBL: CHEMBL2568] [UniProtKB: P06737]
Created with Highcharts 10.3.3ValuesChart context menuLiver glycogen phosphorylasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuLong-chain-fatty-acid--CoA ligase 5pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • macrophage stimulating 1 receptor/Macrophage-stimulating protein receptor in Human [ChEMBL: CHEMBL2689] [GtoPdb: 1816] [UniProtKB: Q04912]
Created with Highcharts 10.3.3ValuesChart context menuMacrophage-stimulating protein receptorpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • MAPK activated protein kinase 2/MAP kinase-activated protein kinase 2 in Human [ChEMBL: CHEMBL2208] [GtoPdb: 2094] [UniProtKB: P49137]
Created with Highcharts 10.3.3ValuesChart context menuMAP kinase-activated protein kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • MAPK activated protein kinase 5/MAP kinase-activated protein kinase 5 in Human [ChEMBL: CHEMBL3094] [GtoPdb: 2096] [UniProtKB: Q8IW41]
Created with Highcharts 10.3.3ValuesChart context menuMAP kinase-activated protein kinase 5pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase 3/MAP kinase ERK1 in Human [ChEMBL: CHEMBL3385] [GtoPdb: 1494] [UniProtKB: P27361]
Created with Highcharts 10.3.3ValuesChart context menuMAP kinase ERK1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase 1/MAP kinase ERK2 in Human [ChEMBL: CHEMBL4040] [GtoPdb: 1495] [UniProtKB: P28482]
Created with Highcharts 10.3.3ValuesChart context menuMAP kinase ERK2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase 14/MAP kinase p38 alpha in Human [ChEMBL: CHEMBL260] [GtoPdb: 1499] [UniProtKB: Q16539]
Created with Highcharts 10.3.3ValuesChart context menuMAP kinase p38 alphapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase 11/MAP kinase p38 beta in Human [ChEMBL: CHEMBL3961] [GtoPdb: 1500] [UniProtKB: Q15759]
Created with Highcharts 10.3.3ValuesChart context menuMAP kinase p38 betapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • microtubule affinity regulating kinase 2/MAP/microtubule affinity-regulating kinase 2 in Human [ChEMBL: CHEMBL3831] [GtoPdb: 2098] [UniProtKB: Q7KZI7]
Created with Highcharts 10.3.3ValuesChart context menuMAP/microtubule affinity-regulating kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • microtubule affinity regulating kinase 4/MAP/microtubule affinity-regulating kinase 4 in Human [ChEMBL: CHEMBL5754] [GtoPdb: 2100] [UniProtKB: Q96L34]
Created with Highcharts 10.3.3ValuesChart context menuMAP/microtubule affinity-regulating kinase 4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • maternal embryonic leucine zipper kinase/Maternal embryonic leucine zipper kinase in Human [ChEMBL: CHEMBL4578] [GtoPdb: 2102] [UniProtKB: Q14680]
Created with Highcharts 10.3.3ValuesChart context menuMaternal embryonic leucine zipper kinasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Membrane-associated progesterone receptor component 1 in Human [ChEMBL: CHEMBL4105706] [UniProtKB: O00264]
Created with Highcharts 10.3.3ValuesChart context menuMembrane-associated progesterone receptor component 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuMidasinpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • misshapen like kinase 1/Misshapen-like kinase 1 in Human [ChEMBL: CHEMBL5518] [GtoPdb: 2103] [UniProtKB: Q8N4C8]
Created with Highcharts 10.3.3ValuesChart context menuMisshapen-like kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase 15/Mitogen-activated protein kinase 15 in Human [ChEMBL: CHEMBL5198] [GtoPdb: 2090] [UniProtKB: Q8TD08]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase 15pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase 7/Mitogen-activated protein kinase 7 in Human [ChEMBL: CHEMBL5332] [GtoPdb: 2093] [UniProtKB: Q13164]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase 7pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase kinase 1/Mitogen-activated protein kinase kinase kinase 1 in Human [ChEMBL: CHEMBL3956] [GtoPdb: 2069] [UniProtKB: Q13233]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase kinase kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase kinase 11/Mitogen-activated protein kinase kinase kinase 11 in Human [ChEMBL: CHEMBL2708] [GtoPdb: 2071] [UniProtKB: Q16584]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase kinase kinase 11pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase kinase 2/Mitogen-activated protein kinase kinase kinase 2 in Human [ChEMBL: CHEMBL5914] [GtoPdb: 2077] [UniProtKB: Q9Y2U5]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase kinase kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase kinase 3/Mitogen-activated protein kinase kinase kinase 3 in Human [ChEMBL: CHEMBL5970] [GtoPdb: 2078] [UniProtKB: Q99759]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase kinase kinase 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase kinase 4/Mitogen-activated protein kinase kinase kinase 4 in Human [ChEMBL: CHEMBL4853] [GtoPdb: 2079] [UniProtKB: Q9Y6R4]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase kinase kinase 4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase kinase 5/Mitogen-activated protein kinase kinase kinase 5 in Human [ChEMBL: CHEMBL5285] [GtoPdb: 2080] [UniProtKB: Q99683]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase kinase kinase 5pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase kinase 6/Mitogen-activated protein kinase kinase kinase 6 in Human [ChEMBL: CHEMBL1163123] [GtoPdb: 2081] [UniProtKB: O95382]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase kinase kinase 6pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase kinase kinase 1/Mitogen-activated protein kinase kinase kinase kinase 1 in Human [ChEMBL: CHEMBL5749] [GtoPdb: 2085] [UniProtKB: Q92918]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase kinase kinase kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase kinase kinase 2/Mitogen-activated protein kinase kinase kinase kinase 2 in Human [ChEMBL: CHEMBL5330] [GtoPdb: 2086] [UniProtKB: Q12851]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase kinase kinase kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase kinase kinase 3/Mitogen-activated protein kinase kinase kinase kinase 3 in Human [ChEMBL: CHEMBL5432] [GtoPdb: 2087] [UniProtKB: Q8IVH8]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase kinase kinase kinase 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase kinase kinase 4/Mitogen-activated protein kinase kinase kinase kinase 4 in Human [ChEMBL: CHEMBL6166] [GtoPdb: 2088] [UniProtKB: O95819]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase kinase kinase kinase 4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • mitogen-activated protein kinase kinase kinase kinase 5/Mitogen-activated protein kinase kinase kinase kinase 5 in Human [ChEMBL: CHEMBL4852] [GtoPdb: 2089] [UniProtKB: Q9Y4K4]
Created with Highcharts 10.3.3ValuesChart context menuMitogen-activated protein kinase kinase kinase kinase 5pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • BUB1 mitotic checkpoint serine/threonine kinase/Mitotic checkpoint serine/threonine-protein kinase BUB1 in Human [ChEMBL: CHEMBL1772932] [GtoPdb: 1949] [UniProtKB: O43683]
Created with Highcharts 10.3.3ValuesChart context menuMitotic checkpoint serine/threonine-protein kinase BUB1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • ZAK sterile alpha motif and leucine zipper containing kinase AZK/Mixed lineage kinase 7 in Human [ChEMBL: CHEMBL3886] [GtoPdb: 2289] [UniProtKB: Q9NYL2]
Created with Highcharts 10.3.3ValuesChart context menuMixed lineage kinase 7pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Multifunctional protein ADE2 in Human [ChEMBL: CHEMBL5922] [UniProtKB: P22234]
Created with Highcharts 10.3.3ValuesChart context menuMultifunctional protein ADE2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuMyosin-10pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuMyosin-14pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • myosin light chain kinase 3/Myosin light chain kinase in Human [ChEMBL: CHEMBL4627] [GtoPdb: 2110] [UniProtKB: Q32MK0]
Created with Highcharts 10.3.3ValuesChart context menuMyosin light chain kinasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • myosin light chain kinase/Myosin light chain kinase, smooth muscle in Human [ChEMBL: CHEMBL2428] [GtoPdb: 1552] [UniProtKB: Q15746]
Created with Highcharts 10.3.3ValuesChart context menuMyosin light chain kinase, smooth musclepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 in Human [ChEMBL: CHEMBL4105781] [UniProtKB: Q9P0J0]
Created with Highcharts 10.3.3ValuesChart context menuNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • neurotrophic receptor tyrosine kinase 1/Nerve growth factor receptor Trk-A in Human [ChEMBL: CHEMBL2815] [GtoPdb: 1817] [UniProtKB: P04629]
Created with Highcharts 10.3.3ValuesChart context menuNerve growth factor receptor Trk-ApKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • tyrosine kinase non receptor 1/Non-receptor tyrosine-protein kinase TNK1 in Human [ChEMBL: CHEMBL5334] [GtoPdb: 2245] [UniProtKB: Q13470]
Created with Highcharts 10.3.3ValuesChart context menuNon-receptor tyrosine-protein kinase TNK1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • NUAK family, SNF1-like kinase, 2/NUAK family SNF1-like kinase 2 in Human [ChEMBL: CHEMBL5698] [GtoPdb: 2130] [UniProtKB: Q9H093]
Created with Highcharts 10.3.3ValuesChart context menuNUAK family SNF1-like kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuNucleolar GTP-binding protein 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuObg-like ATPase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • PAS domain containing serine/threonine kinase/PAS domain-containing serine/threonine-protein kinase in Human [ChEMBL: CHEMBL6054] [GtoPdb: 2139] [UniProtKB: Q96RG2]
Created with Highcharts 10.3.3ValuesChart context menuPAS domain-containing serine/threonine-protein kinasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuPeroxisomal acyl-coenzyme A oxidase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuPeroxisomal acyl-coenzyme A oxidase 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuPhenylalanine--tRNA ligase beta subunitpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Phosphatidylethanolamine-binding protein 1 in Human [ChEMBL: CHEMBL4105856] [UniProtKB: P30086]
Created with Highcharts 10.3.3ValuesChart context menuPhosphatidylethanolamine-binding protein 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • phosphatidylinositol-5-phosphate 4-kinase type 2 alpha/Phosphatidylinositol-5-phosphate 4-kinase type-2 alpha in Human [ChEMBL: CHEMBL1795194] [GtoPdb: 2858] [UniProtKB: P48426]
Created with Highcharts 10.3.3ValuesChart context menuPhosphatidylinositol-5-phosphate 4-kinase type-2 alphapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • phosphatidylinositol-5-phosphate 4-kinase type 2 gamma/Phosphatidylinositol-5-phosphate 4-kinase type-2 gamma in Human [ChEMBL: CHEMBL1770034] [GtoPdb: 2163] [UniProtKB: Q8TBX8]
Created with Highcharts 10.3.3ValuesChart context menuPhosphatidylinositol-5-phosphate 4-kinase type-2 gammapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Phosphofructokinase platelet type in Human [ChEMBL: CHEMBL2972] [UniProtKB: Q01813]
Created with Highcharts 10.3.3ValuesChart context menuPhosphofructokinase platelet typepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • phosphorylase kinase catalytic subunit gamma 2/Phosphorylase kinase gamma subunit 2 in Human [ChEMBL: CHEMBL2349] [GtoPdb: 2147] [UniProtKB: P15735]
Created with Highcharts 10.3.3ValuesChart context menuPhosphorylase kinase gamma subunit 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • platelet derived growth factor receptor beta/Platelet-derived growth factor receptor beta in Human [ChEMBL: CHEMBL1913] [GtoPdb: 1804] [UniProtKB: P09619]
Created with Highcharts 10.3.3ValuesChart context menuPlatelet-derived growth factor receptor betapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Probable ATP-dependent RNA helicase DDX6 in Human [ChEMBL: CHEMBL4105783] [UniProtKB: P26196]
Created with Highcharts 10.3.3ValuesChart context menuProbable ATP-dependent RNA helicase DDX6pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase C alpha/Protein kinase C alpha in Human [ChEMBL: CHEMBL299] [GtoPdb: 1482] [UniProtKB: P17252]
Created with Highcharts 10.3.3ValuesChart context menuProtein kinase C alphapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase C beta/Protein kinase C beta in Human [ChEMBL: CHEMBL3045] [GtoPdb: 1483] [UniProtKB: P05771]
Created with Highcharts 10.3.3ValuesChart context menuProtein kinase C betapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase C delta/Protein kinase C delta in Human [ChEMBL: CHEMBL2996] [GtoPdb: 1485] [UniProtKB: Q05655]
Created with Highcharts 10.3.3ValuesChart context menuProtein kinase C deltapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase C iota/Protein kinase C iota in Human [ChEMBL: CHEMBL2598] [GtoPdb: 1490] [UniProtKB: P41743]
Created with Highcharts 10.3.3ValuesChart context menuProtein kinase C iotapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase D3/Protein kinase C nu in Human [ChEMBL: CHEMBL2595] [GtoPdb: 2174] [UniProtKB: O94806]
Created with Highcharts 10.3.3ValuesChart context menuProtein kinase C nupKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase C theta/Protein kinase C theta in Human [ChEMBL: CHEMBL3920] [GtoPdb: 1488] [UniProtKB: Q04759]
Created with Highcharts 10.3.3ValuesChart context menuProtein kinase C thetapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase C zeta/Protein kinase C zeta in Human [ChEMBL: CHEMBL3438] [GtoPdb: 1491] [UniProtKB: Q05513]
Created with Highcharts 10.3.3ValuesChart context menuProtein kinase C zetapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase N1/Protein kinase N1 in Human [ChEMBL: CHEMBL3384] [GtoPdb: 1520] [UniProtKB: Q16512]
Created with Highcharts 10.3.3ValuesChart context menuProtein kinase N1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase N2/Protein kinase N2 in Human [ChEMBL: CHEMBL3032] [GtoPdb: 1521] [UniProtKB: Q16513]
Created with Highcharts 10.3.3ValuesChart context menuProtein kinase N2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein tyrosine kinase 2 beta/Protein tyrosine kinase 2 beta in Human [ChEMBL: CHEMBL5469] [GtoPdb: 2181] [UniProtKB: Q14289]
Created with Highcharts 10.3.3ValuesChart context menuProtein tyrosine kinase 2 betapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • MER proto-oncogene, tyrosine kinase/Proto-oncogene tyrosine-protein kinase MER in Human [ChEMBL: CHEMBL5331] [GtoPdb: 1837] [UniProtKB: Q12866]
Created with Highcharts 10.3.3ValuesChart context menuProto-oncogene tyrosine-protein kinase MERpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Putative heat shock protein HSP 90-beta 2 in Human [ChEMBL: CHEMBL4105858] [UniProtKB: Q58FF8]
Created with Highcharts 10.3.3ValuesChart context menuPutative heat shock protein HSP 90-beta 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuPyridoxal kinasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuQuinone reductase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuRab-like protein 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuRas-related protein Rab-10pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • RAB27A, member RAS oncogene family/Ras-related protein Rab-27A in Human [ChEMBL: CHEMBL4105702] [GtoPdb: 2916] [UniProtKB: P51159]
Created with Highcharts 10.3.3ValuesChart context menuRas-related protein Rab-27ApKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuRas-related protein Rab-6ApKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • receptor interacting serine/threonine kinase 3/Receptor-interacting serine/threonine-protein kinase 3 in Human [ChEMBL: CHEMBL1795199] [GtoPdb: 2191] [UniProtKB: Q9Y572]
Created with Highcharts 10.3.3ValuesChart context menuReceptor-interacting serine/threonine-protein kinase 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Rho associated coiled-coil containing protein kinase 1/Rho-associated protein kinase 1 in Human [ChEMBL: CHEMBL3231] [GtoPdb: 1503] [UniProtKB: Q13464]
Created with Highcharts 10.3.3ValuesChart context menuRho-associated protein kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Rho associated coiled-coil containing protein kinase 2/Rho-associated protein kinase 2 in Human [ChEMBL: CHEMBL2973] [GtoPdb: 1504] [UniProtKB: O75116]
Created with Highcharts 10.3.3ValuesChart context menuRho-associated protein kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • ribosomal protein S6 kinase B1/Ribosomal protein S6 kinase 1 in Human [ChEMBL: CHEMBL4501] [GtoPdb: 1525] [UniProtKB: P23443]
Created with Highcharts 10.3.3ValuesChart context menuRibosomal protein S6 kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • ribosomal protein S6 kinase A1/Ribosomal protein S6 kinase alpha 1 in Human [ChEMBL: CHEMBL2553] [GtoPdb: 1527] [UniProtKB: Q15418]
Created with Highcharts 10.3.3ValuesChart context menuRibosomal protein S6 kinase alpha 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • ribosomal protein S6 kinase A3/Ribosomal protein S6 kinase alpha 3 in Human [ChEMBL: CHEMBL2345] [GtoPdb: 1528] [UniProtKB: P51812]
Created with Highcharts 10.3.3ValuesChart context menuRibosomal protein S6 kinase alpha 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • ribosomal protein S6 kinase A4/Ribosomal protein S6 kinase alpha 4 in Human [ChEMBL: CHEMBL3125] [GtoPdb: 1524] [UniProtKB: O75676]
Created with Highcharts 10.3.3ValuesChart context menuRibosomal protein S6 kinase alpha 4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • ribosomal protein S6 kinase A5/Ribosomal protein S6 kinase alpha 5 in Human [ChEMBL: CHEMBL4237] [GtoPdb: 1523] [UniProtKB: O75582]
Created with Highcharts 10.3.3ValuesChart context menuRibosomal protein S6 kinase alpha 5pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • ribosomal protein S6 kinase A6/Ribosomal protein S6 kinase alpha 6 in Human [ChEMBL: CHEMBL4924] [GtoPdb: 1530] [UniProtKB: Q9UK32]
Created with Highcharts 10.3.3ValuesChart context menuRibosomal protein S6 kinase alpha 6pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuRNA cytidine acetyltransferasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • S-adenosylmethionine synthase isoform type-2 in Human [ChEMBL: CHEMBL3313835] [UniProtKB: P31153]
Created with Highcharts 10.3.3ValuesChart context menuS-adenosylmethionine synthase isoform type-2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuSeptin-9pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • ATR checkpoint kinase/Serine-protein kinase ATR in Human [ChEMBL: CHEMBL5024] [GtoPdb: 1935] [UniProtKB: Q13535]
Created with Highcharts 10.3.3ValuesChart context menuSerine-protein kinase ATRpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • serine/threonine kinase 10/Serine/threonine-protein kinase 10 in Human [ChEMBL: CHEMBL3981] [GtoPdb: 2211] [UniProtKB: O94804]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase 10pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • serine/threonine kinase 11/Serine/threonine-protein kinase 11 in Human [ChEMBL: CHEMBL5606] [GtoPdb: 2212] [UniProtKB: Q15831]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase 11pKd HumanpKi HumanpIC50 HumanpEC50 Human01234567Highcharts.com
  • serine/threonine kinase 16/Serine/threonine-protein kinase 16 in Human [ChEMBL: CHEMBL3938] [GtoPdb: 2213] [UniProtKB: O75716]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase 16pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • STE20 like kinase/Serine/threonine-protein kinase 2 in Human [ChEMBL: CHEMBL4202] [GtoPdb: 2200] [UniProtKB: Q9H2G2]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • serine/threonine kinase 24/Serine/threonine-protein kinase 24 in Human [ChEMBL: CHEMBL5082] [GtoPdb: 2217] [UniProtKB: Q9Y6E0]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase 24pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Serine/threonine kinase 38 like/Serine/threonine-protein kinase 38-like in Human [ChEMBL: CHEMBL4851] [GtoPdb: 1518] [UniProtKB: Q9Y2H1]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase 38-likepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • AKT serine/threonine kinase 1/Serine/threonine-protein kinase AKT in Human [ChEMBL: CHEMBL4282] [GtoPdb: 1479] [UniProtKB: P31749]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase AKTpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • AKT serine/threonine kinase 2/Serine/threonine-protein kinase AKT2 in Human [ChEMBL: CHEMBL2431] [GtoPdb: 1480] [UniProtKB: P31751]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase AKT2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • AKT serine/threonine kinase 3/Serine/threonine-protein kinase AKT3 in Human [ChEMBL: CHEMBL4816] [GtoPdb: 2286] [UniProtKB: Q9Y243]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase AKT3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • A-Raf proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase A-Raf in Human [ChEMBL: CHEMBL1169596] [GtoPdb: 1933] [UniProtKB: P10398]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase A-RafpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • aurora kinase A/Serine/threonine-protein kinase Aurora-A in Human [ChEMBL: CHEMBL4722] [GtoPdb: 1936] [UniProtKB: O14965]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase Aurora-ApKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • aurora kinase B/Serine/threonine-protein kinase Aurora-B in Human [ChEMBL: CHEMBL2185] [GtoPdb: 1937] [UniProtKB: Q96GD4]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase Aurora-BpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • B-Raf proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase B-raf in Human [ChEMBL: CHEMBL5145] [GtoPdb: 1943] [UniProtKB: P15056]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase B-rafpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • checkpoint kinase 1/Serine/threonine-protein kinase Chk1 in Human [ChEMBL: CHEMBL4630] [GtoPdb: 1987] [UniProtKB: O14757]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase Chk1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • microtubule affinity regulating kinase 3/Serine/threonine-protein kinase c-TAK1 in Human [ChEMBL: CHEMBL5600] [GtoPdb: 2099] [UniProtKB: P27448]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase c-TAK1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase D2/Serine/threonine-protein kinase D2 in Human [ChEMBL: CHEMBL4900] [GtoPdb: 2173] [UniProtKB: Q9BZL6]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase D2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • endoplasmic reticulum to nucleus signaling 1/Serine/threonine-protein kinase/endoribonuclease IRE1 in Human [ChEMBL: CHEMBL1163101] [GtoPdb: 2020] [UniProtKB: O75460]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase/endoribonuclease IRE1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • endoplasmic reticulum to nucleus signaling 2/Serine/threonine-protein kinase/endoribonuclease IRE2 in Human [ChEMBL: CHEMBL4105932] [GtoPdb: 2021] [UniProtKB: Q76MJ5]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase/endoribonuclease IRE2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • cyclin G associated kinase/Serine/threonine-protein kinase GAK in Human [ChEMBL: CHEMBL4355] [GtoPdb: 2027] [UniProtKB: O14976]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase GAKpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • ciliogenesis associated kinase 1/Serine/threonine-protein kinase ICK in Human [ChEMBL: CHEMBL1163126] [GtoPdb: 2038] [UniProtKB: Q9UPZ9]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase ICKpKd HumanpKi HumanpIC50 HumanpEC50 Human02468Highcharts.com
  • integrin linked kinase/Serine/threonine-protein kinase ILK-1 in Human [ChEMBL: CHEMBL5247] [GtoPdb: 2041] [UniProtKB: Q13418]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase ILK-1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • large tumor suppressor kinase 1/Serine/threonine-protein kinase LATS1 in Human [ChEMBL: CHEMBL6167] [GtoPdb: 1515] [UniProtKB: O95835]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase LATS1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • CDC42 binding protein kinase alpha/Serine/threonine-protein kinase MRCK-A in Human [ChEMBL: CHEMBL4516] [GtoPdb: 1507] [UniProtKB: Q5VT25]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase MRCK-ApKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • CDC42 binding protein kinase beta/Serine/threonine-protein kinase MRCK beta in Human [ChEMBL: CHEMBL5052] [GtoPdb: 1508] [UniProtKB: Q9Y5S2]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase MRCK betapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • CDC42 binding protein kinase gamma/Serine/threonine-protein kinase MRCK gamma in Human [ChEMBL: CHEMBL5615] [GtoPdb: 1506] [UniProtKB: Q6DT37]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase MRCK gammapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • serine/threonine kinase 4/Serine/threonine-protein kinase MST1 in Human [ChEMBL: CHEMBL4598] [GtoPdb: 2225] [UniProtKB: Q13043]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase MST1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • serine/threonine kinase 3/Serine/threonine-protein kinase MST2 in Human [ChEMBL: CHEMBL4708] [GtoPdb: 2219] [UniProtKB: Q13188]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase MST2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • serine/threonine-protein kinase MST4/Serine/threonine-protein kinase MST4 in Human [ChEMBL: CHEMBL5941] [GtoPdb: 2287] [UniProtKB: Q9P289]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase MST4pKd HumanpKi HumanpIC50 HumanpEC50 Human02468Highcharts.com
  • protein kinase N3/Serine/threonine-protein kinase N3 in Human [ChEMBL: CHEMBL3627581] [GtoPdb: 1522] [UniProtKB: Q6P5Z2]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase N3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • NIMA related kinase 1/Serine/threonine-protein kinase Nek1 in Human [ChEMBL: CHEMBL5855] [GtoPdb: 2114] [UniProtKB: Q96PY6]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase Nek1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • NIMA related kinase 2/Serine/threonine-protein kinase NEK2 in Human [ChEMBL: CHEMBL3835] [GtoPdb: 2117] [UniProtKB: P51955]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase NEK2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • NIMA related kinase 3/Serine/threonine-protein kinase Nek3 in Human [ChEMBL: CHEMBL5679] [GtoPdb: 2118] [UniProtKB: P51956]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase Nek3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • NIMA related kinase 7/Serine/threonine-protein kinase NEK7 in Human [ChEMBL: CHEMBL4849] [GtoPdb: 2122] [UniProtKB: Q8TDX7]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase NEK7pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • NIMA related kinase 9/Serine/threonine-protein kinase NEK9 in Human [ChEMBL: CHEMBL5257] [GtoPdb: 2124] [UniProtKB: Q8TD19]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase NEK9pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • nemo like kinase/Serine/threonine protein kinase NLK in Human [ChEMBL: CHEMBL5364] [GtoPdb: 2125] [UniProtKB: Q9UBE8]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine protein kinase NLKpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • p21 (RAC1) activated kinase 2/Serine/threonine-protein kinase PAK 2 in Human [ChEMBL: CHEMBL4487] [GtoPdb: 2134] [UniProtKB: Q13177]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase PAK 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • p21 (RAC1) activated kinase 4/Serine/threonine-protein kinase PAK 4 in Human [ChEMBL: CHEMBL4482] [GtoPdb: 2136] [UniProtKB: O96013]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase PAK 4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • p21 (RAC1) activated kinase 6/Serine/threonine-protein kinase PAK6 in Human [ChEMBL: CHEMBL4311] [GtoPdb: 2137] [UniProtKB: Q9NQU5]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase PAK6pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • cyclin dependent kinase 16/Serine/threonine-protein kinase PCTAIRE-1 in Human [ChEMBL: CHEMBL4597] [GtoPdb: 1969] [UniProtKB: Q00536]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase PCTAIRE-1pKd HumanpKi HumanpIC50 HumanpEC50 Human02468Highcharts.com
  • cyclin dependent kinase 17/Serine/threonine-protein kinase PCTAIRE-2 in Human [ChEMBL: CHEMBL5790] [GtoPdb: 1970] [UniProtKB: Q00537]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase PCTAIRE-2pKd HumanpKi HumanpIC50 HumanpEC50 Human01234567Highcharts.com
  • Pim-1 proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase PIM1 in Human [ChEMBL: CHEMBL2147] [GtoPdb: 2158] [UniProtKB: P11309]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase PIM1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Pim-2 proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase PIM2 in Human [ChEMBL: CHEMBL4523] [GtoPdb: 2159] [UniProtKB: Q9P1W9]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase PIM2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • polo like kinase 4/Serine/threonine-protein kinase PLK4 in Human [ChEMBL: CHEMBL3788] [GtoPdb: 2171] [UniProtKB: O00444]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase PLK4pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • receptor interacting serine/threonine kinase 2/Serine/threonine-protein kinase RIPK2 in Human [ChEMBL: CHEMBL5014] [GtoPdb: 2190] [UniProtKB: O43353]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase RIPK2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • salt inducible kinase 2/Serine/threonine-protein kinase SIK2 in Human [ChEMBL: CHEMBL5699] [GtoPdb: 2198] [UniProtKB: Q9H0K1]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase SIK2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • SIK family kinase 3/Serine/threonine-protein kinase SIK3 in Human [ChEMBL: CHEMBL6149] [GtoPdb: 2199] [UniProtKB: Q9Y2K2]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase SIK3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • TAO kinase 1/Serine/threonine-protein kinase TAO1 in Human [ChEMBL: CHEMBL5261] [GtoPdb: 2233] [UniProtKB: Q7L7X3]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase TAO1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • TAO kinase 2/Serine/threonine-protein kinase TAO2 in Human [ChEMBL: CHEMBL1075195] [GtoPdb: 2234] [UniProtKB: Q9UL54]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase TAO2pKd HumanpKi HumanpIC50 HumanpEC50 Human0123456Highcharts.com
  • TAO kinase 3/Serine/threonine-protein kinase TAO3 in Human [ChEMBL: CHEMBL5701] [GtoPdb: 2235] [UniProtKB: Q9H2K8]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase TAO3pKd HumanpKi HumanpIC50 HumanpEC50 Human0123456Highcharts.com
  • TANK binding kinase 1/Serine/threonine-protein kinase TBK1 in Human [ChEMBL: CHEMBL5408] [GtoPdb: 2237] [UniProtKB: Q9UHD2]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase TBK1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • unc-51 like autophagy activating kinase 1/Serine/threonine-protein kinase ULK1 in Human [ChEMBL: CHEMBL6006] [GtoPdb: 2271] [UniProtKB: O75385]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase ULK1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • unc-51 like kinase 3/Serine/threonine-protein kinase ULK3 in Human [ChEMBL: CHEMBL5047] [GtoPdb: 2273] [UniProtKB: Q6PHR2]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase ULK3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • WEE1 G2 checkpoint kinase/Serine/threonine-protein kinase WEE1 in Human [ChEMBL: CHEMBL5491] [GtoPdb: 2278] [UniProtKB: P30291]
Created with Highcharts 10.3.3ValuesChart context menuSerine/threonine-protein kinase WEE1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Signal recognition particle receptor subunit alpha in Human [ChEMBL: CHEMBL4105934] [UniProtKB: P08240]
Created with Highcharts 10.3.3ValuesChart context menuSignal recognition particle receptor subunit alphapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • STE20 related adaptor alpha/STE20-related kinase adapter protein alpha in Human [ChEMBL: CHEMBL1795198] [GtoPdb: 2227] [UniProtKB: Q7RTN6]
Created with Highcharts 10.3.3ValuesChart context menuSTE20-related kinase adapter protein alphapKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Structural maintenance of chromosomes protein 1A in Human [ChEMBL: CHEMBL4105747] [UniProtKB: Q14683]
Created with Highcharts 10.3.3ValuesChart context menuStructural maintenance of chromosomes protein 1ApKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Structural maintenance of chromosomes protein 2 in Human [ChEMBL: CHEMBL4105890] [UniProtKB: O95347]
Created with Highcharts 10.3.3ValuesChart context menuStructural maintenance of chromosomes protein 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial in Human [ChEMBL: CHEMBL4105973] [UniProtKB: Q9P2R7]
Created with Highcharts 10.3.3ValuesChart context menuSuccinate--CoA ligase [ADP-forming] subunit beta, mitochondrialpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • transforming growth factor beta receptor 1/TGF-beta receptor type I in Human [ChEMBL: CHEMBL4439] [GtoPdb: 1788] [UniProtKB: P36897]
Created with Highcharts 10.3.3ValuesChart context menuTGF-beta receptor type IpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • transforming growth factor beta receptor 2/TGF-beta receptor type II in Human [ChEMBL: CHEMBL4267] [GtoPdb: 1795] [UniProtKB: P37173]
Created with Highcharts 10.3.3ValuesChart context menuTGF-beta receptor type IIpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Thyroid hormone receptor-associated protein 3 in Human [ChEMBL: CHEMBL4105820] [UniProtKB: Q9Y2W1]
Created with Highcharts 10.3.3ValuesChart context menuThyroid hormone receptor-associated protein 3pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • TP53 regulating kinase/TP53-regulating kinase in Human [ChEMBL: CHEMBL1938223] [GtoPdb: 2248] [UniProtKB: Q96S44]
Created with Highcharts 10.3.3ValuesChart context menuTP53-regulating kinasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • TRAF2 and NCK interacting kinase/TRAF2- and NCK-interacting kinase in Human [ChEMBL: CHEMBL4527] [GtoPdb: 2244] [UniProtKB: Q9UKE5]
Created with Highcharts 10.3.3ValuesChart context menuTRAF2- and NCK-interacting kinasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein kinase, membrane associated tyrosine/threonine 1/Tyrosine- and threonine-specific cdc2-inhibitory kinase in Human [ChEMBL: CHEMBL3984] [GtoPdb: 2167] [UniProtKB: Q99640]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine- and threonine-specific cdc2-inhibitory kinasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • tyrosine kinase non receptor 2/Tyrosine kinase non-receptor protein 2 in Human [ChEMBL: CHEMBL4599] [GtoPdb: 2246] [UniProtKB: Q07912]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine kinase non-receptor protein 2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • ABL proto-oncogene 1, non-receptor tyrosine kinase/Tyrosine-protein kinase ABL in Human [ChEMBL: CHEMBL1862] [GtoPdb: 1923] [UniProtKB: P00519]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase ABLpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • ABL proto-oncogene 2, non-receptor tyrosine kinase/Tyrosine-protein kinase ABL2 in Human [ChEMBL: CHEMBL4014] [GtoPdb: 1924] [UniProtKB: P42684]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase ABL2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • protein tyrosine kinase 6/Tyrosine-protein kinase BRK in Human [ChEMBL: CHEMBL4601] [GtoPdb: 2182] [UniProtKB: Q13882]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase BRKpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Bruton tyrosine kinase/Tyrosine-protein kinase BTK in Human [ChEMBL: CHEMBL5251] [GtoPdb: 1948] [UniProtKB: Q06187]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase BTKpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • C-terminal Src kinase/Tyrosine-protein kinase CSK in Human [ChEMBL: CHEMBL2634] [GtoPdb: 1994] [UniProtKB: P41240]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase CSKpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • FER tyrosine kinase/Tyrosine-protein kinase FER in Human [ChEMBL: CHEMBL3982] [GtoPdb: 2022] [UniProtKB: P16591]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase FERpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • FES proto-oncogene, tyrosine kinase/Tyrosine-protein kinase FES in Human [ChEMBL: CHEMBL5455] [GtoPdb: 2023] [UniProtKB: P07332]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase FESpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • fyn related Src family tyrosine kinase/Tyrosine-protein kinase FRK in Human [ChEMBL: CHEMBL4223] [GtoPdb: 2025] [UniProtKB: P42685]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase FRKpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • FYN proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase FYN in Human [ChEMBL: CHEMBL1841] [GtoPdb: 2026] [UniProtKB: P06241]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase FYNpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • HCK proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase HCK in Human [ChEMBL: CHEMBL3234] [GtoPdb: 2032] [UniProtKB: P08631]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase HCKpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Janus kinase 1/Tyrosine-protein kinase JAK1 in Human [ChEMBL: CHEMBL2835] [GtoPdb: 2047] [UniProtKB: P23458]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase JAK1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • LCK proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase LCK in Human [ChEMBL: CHEMBL258] [GtoPdb: 2053] [UniProtKB: P06239]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase LCKpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • LYN proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase Lyn in Human [ChEMBL: CHEMBL3905] [GtoPdb: 2060] [UniProtKB: P07948]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase LynpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • fms related receptor tyrosine kinase 3/Tyrosine-protein kinase receptor FLT3 in Human [ChEMBL: CHEMBL1974] [GtoPdb: 1807] [UniProtKB: P36888]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase receptor FLT3pKd HumanpKi HumanpIC50 HumanpEC50 Human0123456Highcharts.com
  • ret proto-oncogene/Tyrosine-protein kinase receptor RET in Human [ChEMBL: CHEMBL2041] [GtoPdb: 2185] [UniProtKB: P07949]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase receptor RETpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • SRC proto-oncogene, non-receptor tyrosine kinase/Tyrosine-protein kinase SRC in Human [ChEMBL: CHEMBL267] [GtoPdb: 2206] [UniProtKB: P12931]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase SRCpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • spleen associated tyrosine kinase/Tyrosine-protein kinase SYK in Human [ChEMBL: CHEMBL2599] [GtoPdb: 2230] [UniProtKB: P43405]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase SYKpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • tec protein tyrosine kinase/Tyrosine-protein kinase TEC in Human [ChEMBL: CHEMBL4246] [GtoPdb: 2238] [UniProtKB: P42680]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase TECpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • tyrosine kinase 2/Tyrosine-protein kinase TYK2 in Human [ChEMBL: CHEMBL3553] [GtoPdb: 2269] [UniProtKB: P29597]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase TYK2pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • YES proto-oncogene 1, Src family tyrosine kinase/Tyrosine-protein kinase YES in Human [ChEMBL: CHEMBL2073] [GtoPdb: 2284] [UniProtKB: P07947]
Created with Highcharts 10.3.3ValuesChart context menuTyrosine-protein kinase YESpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuTyrosyl-tRNA synthetasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • U5 small nuclear ribonucleoprotein 200 kDa helicase in Human [ChEMBL: CHEMBL4105972] [UniProtKB: O75643]
Created with Highcharts 10.3.3ValuesChart context menuU5 small nuclear ribonucleoprotein 200 kDa helicasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuUMP-CMP kinasepKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • aarF domain containing kinase 1/Uncharacterized aarF domain-containing protein kinase 1 in Human [ChEMBL: CHEMBL4105885] [GtoPdb: 1925] [UniProtKB: Q86TW2]
Created with Highcharts 10.3.3ValuesChart context menuUncharacterized aarF domain-containing protein kinase 1pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • aarF domain containing kinase 5/Uncharacterized aarF domain-containing protein kinase 5 in Human [ChEMBL: CHEMBL4105886] [GtoPdb: 1929] [UniProtKB: Q3MIX3]
Created with Highcharts 10.3.3ValuesChart context menuUncharacterized aarF domain-containing protein kinase 5pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
Created with Highcharts 10.3.3ValuesChart context menuUncharacterized protein FLJ45252pKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
  • Very long-chain specific acyl-CoA dehydrogenase, mitochondrial in Human [ChEMBL: CHEMBL4105892] [UniProtKB: P49748]
Created with Highcharts 10.3.3ValuesChart context menuVery long-chain specific acyl-CoA dehydrogenase, mitochondrialpKd HumanpKi HumanpIC50 HumanpEC50 Human012345Highcharts.com
DB Assay description Assay Type Standard value Standard parameter Original value Original units Original parameter Reference
26S protease regulatory subunit 6B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3831205] [UniProtKB: P43686]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Actin-related protein 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6090] [UniProtKB: P61160]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Actin-related protein 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105857] [UniProtKB: P61158]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
activin A receptor type 1/Activin receptor type-1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5903] [GtoPdb: 1785] [UniProtKB: Q04771]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
activin A receptor type 1B/Activin receptor type-1B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5310] [GtoPdb: 1787] [UniProtKB: P36896]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
activin A receptor type 2B/Activin receptor type-2B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5466] [GtoPdb: 1792] [UniProtKB: Q13705]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Acyl-CoA dehydrogenase family member 10 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105816] [UniProtKB: Q6JQN1]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Acyl-CoA dehydrogenase family member 11 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105707] [UniProtKB: Q709F0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
AP2 associated kinase 1/Adaptor-associated kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3830] [GtoPdb: 1921] [UniProtKB: Q2M2I8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Adenine phosphoribosyltransferase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105819] [UniProtKB: P07741]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Adenosine kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3589] [GtoPdb: 1231] [UniProtKB: P55263]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Adenylate kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4938] [UniProtKB: P54819]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Mitochondrial adenine nucleotide translocator 2/ADP/ATP translocase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3709670] [GtoPdb: 1063] [UniProtKB: P05141]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Mitochondrial adenine nucleotide translocator 3/ADP/ATP translocase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105854] [GtoPdb: 1064] [UniProtKB: P12236]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
AKR1C3/Aldo-keto-reductase family 1 member C3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4681] [GtoPdb: 1382] [UniProtKB: P42330]
ChEMBL Inhibition of human AKR1C3 expressed in Escherichia coli incubated for 30 mins in presence of NADPH regeneration system by UHPLC analysis B 7.15 pKi 70 nM Ki J Med Chem (2020) 63: 11305-11329 [PMID:32463235]
ChEMBL Inhibition of AKR1C3 (unknown origin) expressed in human HCT116 cells incubated for 3 to 6 hrs by UHPLC analysis B 6.64 pIC50 230 nM IC50 J Med Chem (2020) 63: 11305-11329 [PMID:32463235]
protein kinase AMP-activated catalytic subunit alpha 1/AMP-activated protein kinase, alpha-1 subunit in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4045] [GtoPdb: 1541] [UniProtKB: Q13131]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase AMP-activated non-catalytic subunit gamma 1/AMP-activated protein kinase, gamma-1 subunit in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2393] [GtoPdb: 1545] [UniProtKB: P54619]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase AMP-activated non-catalytic subunit gamma 2/AMP-activated protein kinase, gamma-2 subunit in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2453] [GtoPdb: 1546] [UniProtKB: Q9UGJ0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ATP-dependent RNA helicase DDX1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2010634] [UniProtKB: Q92499]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ATP-dependent RNA helicase DDX3X in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5553] [UniProtKB: O00571]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ATP-dependent RNA helicase DDX42 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105782] [UniProtKB: Q86XP3]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
BMP2 inducible kinase/BMP-2-inducible protein kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4522] [GtoPdb: 1941] [UniProtKB: Q9NSY1]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
bone morphogenetic protein receptor type IA/Bone morphogenetic protein receptor type-1A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5275] [GtoPdb: 1786] [UniProtKB: P36894]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
bone morphogenetic protein receptor type IB/Bone morphogenetic protein receptor type-1B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5476] [GtoPdb: 1789] [UniProtKB: O00238]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
bone morphogenetic protein receptor type 2/Bone morphogenetic protein receptor type-2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5467] [GtoPdb: 1794] [UniProtKB: Q13873]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Brain glycogen phosphorylase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3856] [UniProtKB: P11216]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
BCR activator of RhoGEF and GTPase/Breakpoint cluster region protein in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5146] [GtoPdb: 2755] [UniProtKB: P11274]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
bromodomain containing 4/Bromodomain-containing protein 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1163125] [GtoPdb: 1945] [UniProtKB: O60885]
ChEMBL Inhibition of N-terminal 6His-tagged human BRD4 bromodomain 1 (44 to 168 residues) expressed in Escherichia coli BL21 (DE3) using biotinylated histone H4 peptide (1 to 21 residues) containing KAc (K5/8/12/16Ac) as substrate by Alpha screen assay B 4.72 pIC50 19000 nM IC50 Nat Rev Drug Discov (2017) 16: 424-440 [PMID:28280261]
bromodomain testis associated/Bromodomain testis-specific protein in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1795185] [GtoPdb: 2729] [UniProtKB: Q58F21]
ChEMBL Inhibition of N-terminal 6His-tagged human BRDT bromodomain 1 (21 to 137 residues) expressed in Escherichia coli BL21 (DE3) using biotinylated histone H4 peptide (1 to 21 residues) containing KAc (K5/8/12/16Ac) as substrate by Alpha screen assay B 4.43 pIC50 37000 nM IC50 Nat Rev Drug Discov (2017) 16: 424-440 [PMID:28280261]
ChEMBL Inhibition of human N-terminal His6-tagged BRDT (21 to 137 residues) expressed in Escherichia coli BL21 (DE3) cells incubated for 1 hr B 4.73 pIC50 18700 nM IC50 J Med Chem (2016) 59: 9305-9320 [PMID:27559828]
calcium/calmodulin-dependent protein kinase II delta subunit/CaM kinase II delta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2801] [GtoPdb: 1558] [UniProtKB: Q13557]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
calcium/calmodulin-dependent protein kinase II gamma subunit/CaM kinase II gamma in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3829] [GtoPdb: 1557] [UniProtKB: Q13555]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
calcium/calmodulin dependent protein kinase IV/CaM kinase IV in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2494] [GtoPdb: 1955] [UniProtKB: Q16566]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
calcium/calmodulin dependent protein kinase kinase 2/CaM-kinase kinase beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5284] [GtoPdb: 1957] [UniProtKB: Q96RR4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase, cAMP-dependent, catalytic, alpha subunit/cAMP-dependent protein kinase alpha-catalytic subunit in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4101] [GtoPdb: 1476] [UniProtKB: P17612]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase, cAMP-dependent, catalytic, beta subunit/cAMP-dependent protein kinase beta-1 catalytic subunit in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2918] [GtoPdb: 1477] [UniProtKB: P22694]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase, cAMP-dependent, catalytic, gamma subunit/cAMP-dependent protein kinase, gamma catalytic subunit in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2743] [GtoPdb: 1478] [UniProtKB: P22612]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase, cAMP-dependent, regulatory, type II, alpha subunit/cAMP-dependent protein kinase type II-alpha regulatory subunit in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2221] [GtoPdb: 1474] [UniProtKB: P13861]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 1 alpha 1/Casein kinase I alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2793] [GtoPdb: 1995] [UniProtKB: P48729]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 1 delta/Casein kinase I delta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2828] [GtoPdb: 1997] [UniProtKB: P48730]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 1 epsilon/Casein kinase I epsilon in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4937] [GtoPdb: 1998] [UniProtKB: P49674]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 1 gamma 1/Casein kinase I gamma 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2426] [GtoPdb: 1999] [UniProtKB: Q9HCP0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 1 gamma 2/Casein kinase I gamma 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2543] [GtoPdb: 2000] [UniProtKB: P78368]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 2, alpha prime polypeptide subunit/Casein kinase II alpha (prime) in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4070] [GtoPdb: 1550] [UniProtKB: P19784]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 1 gamma 3/Casein kinase I isoform gamma-3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5084] [GtoPdb: 2001] [UniProtKB: Q9Y6M4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 12/CDK12/Cyclin K in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL4106169] [GtoPdb: 1965] [UniProtKB: O75909Q9NYV4]
ChEMBL Inhibition of human CDK12 (696 to 1082 residues)/human cyclinK (1 to 267 residues) using pol2 CTD-peptide substrate and [gammaP]ATP by scintillation counting method B 7.4 pIC50 40 nM IC50 J Med Chem (2020) 63: 14151-14183 [PMID:33135887]
ChEMBL Inhibition of GST-tagged human CDK12/Cyclin K expressed in Sf9 cells using RBER-IRStide peptide as substrate in presence of ATP and [gamma33-P] ATP by radioisotope filter binding assay B 8.15 pIC50 7 nM IC50 J Med Chem (2022) 65: 8881-8896 [PMID:35749742]
cyclin dependent kinase 2/CDK2/Cyclin A1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL3038470] [GtoPdb: 1973] [UniProtKB: P24941P78396]
ChEMBL Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method B 8.52 pIC50 3 nM IC50 J Med Chem (2021) 64: 10981-10996 [PMID:34288692]
GtoPdb Inhibition of CDK2/cyclin E complex. - 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
cyclin dependent kinase 2/CDK2/Cyclin A2 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL3038469] [GtoPdb: 1973] [UniProtKB: P20248P24941]
ChEMBL Inhibition of human full length CDK2/CyclinA2 by ADP-Glo kinase assay B 8.12 pIC50 7.51 nM IC50 Eur J Med Chem (2022) 242: 114701-114701 [PMID:36054949]
ChEMBL Inhibition of GST-tagged CDK2/Cyclin-A2 (unknown origin) expressed in Escherichia coli using histone H1 as substrate measured in presence of [gamma-33P]ATP B 8.52 pIC50 3 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb Inhibition of CDK2/cyclin E complex. - 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of recombinant CDK2/cyclin A (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrate after 1 hr by gamma32P-ATP based liquid scintillation counting analysis B 9 pIC50 1 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
cyclin dependent kinase 7/CDK7/Cyclin H/MNAT1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL3038473] [GtoPdb: 1979] [UniProtKB: P50613P51946P51948]
ChEMBL Inhibition of CDK7/Cyclin H/MAT1 (unknown origin) using (YSPTSPS)2KK peptide as substrate in presence of [gamma-33P]ATP B 6.77 pIC50 170 nM IC50 Eur J Med Chem (2016) 108: 701-719 [PMID:26741853]
ChEMBL Inhibition of recombinant human N-terminal GST-His6-fused CDK7 (M1 to F346 residues)/N-terminal His-tagged cyclin H (M1 to L323 residues)/N-terminal His6-tagged MAT1 (M1 to S306 residues) expressed in baculovirus infected Sf9 insect cells using (YSPTSPS)2KK as substrate measured in presence of [gamma-33P]ATP B 6.77 pIC50 170 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
cyclin dependent kinase 9/CDK9/Cyclin T in Human (target type: PROTEIN COMPLEX GROUP) [ChEMBL: CHEMBL5291961] [GtoPdb: 1981] [UniProtKB: O60563O60583P50750]
ChEMBL Inhibition of CDK9/cyclin T (unknown origin) assessed as inhibition constant B 8.4 pKi 4 nM Ki Bioorg Med Chem (2023) 80: 117158-117158 [PMID:36706608]
GtoPdb - - 8.4 pIC50 4 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
cyclin dependent kinase 9/CDK9/cyclin T1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL2111389] [GtoPdb: 1981] [UniProtKB: O60563P50750]
ChEMBL Inhibition of CDK9/Cyclin T1 (unknown origin) using (YSPTSPS)2KK peptide as substrate in presence of [gamma-33P]ATP B 6.75 pIC50 178 nM IC50 Eur J Med Chem (2016) 108: 701-719 [PMID:26741853]
ChEMBL Inhibition of recombinant human N-terminal GST-His6-fused CDK9 (M1 to F372 residues)/N-terminal His6-tagged cyclin T1 (M1 to K726 residues) expressed in baculovirus infected Sf9 insect cells using (YSPTSPS)2KK as substrate measured in presence of [gamma-33P]ATP B 7.82 pIC50 15 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
ChEMBL Inhibition of GST-tagged human CDK9/Cyclin T1 expressed in Sf9 cells using (YSPTSPS)2KK peptide as substrate in presence of ATP and [gamma33-P] ATP by radioisotope filter binding assay B 8.22 pIC50 6 nM IC50 J Med Chem (2022) 65: 8881-8896 [PMID:35749742]
ChEMBL Inhibition of recombinant full-length N-terminal GST-tagged human CDK9 (1 to 372 residues)/full-length His6-tagged human cyclin T1 (1 to 726 residues) expressed in baculovirus expression system using 5'FAM-RRRFRPASPLRGPPK-COOH as substrate after 30 mins by microfluidic assay B 8.4 pIC50 4 nM IC50 Medchemcomm (2016) 7: 1580-1586 [PMID:27746890]
ChEMBL Inhibition of N-terminal GST-HIS6 fusion protein tagged human full length CDK9 (M1 to F372 residues)/N-terminal GST-HIS6 fusion protein tagged human Cyclin-T1 (M1 to K726 residues) expressed in Sf9 cells at 10 uM using TAMRA-Rbtide substrate and ATP incubated for 1 hr by fluorescent polarization assay B 8.4 pIC50 4 nM IC50 Bioorg Med Chem Lett (2018) 28: 769-773 [PMID:29329658]
ChEMBL Inhibition of recombinant CDK9/cyclin T (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrate after 1 hr by gamma32P-ATP based liquid scintillation counting analysis B 8.4 pIC50 4 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
ChEMBL Inhibition of CDK9/Cyclin T (unknown origin) B 8.4 pIC50 4 nM IC50 J Med Chem (2022) 65: 6390-6418 [PMID:35485642]
GtoPdb - - 8.4 pIC50 4 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assay B 8.57 pIC50 2.7 nM IC50 J Med Chem (2021) 64: 12548-12571 [PMID:34415148]
cyclin dependent kinase 8/Cell division protein kinase 8 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5719] [GtoPdb: 1980] [UniProtKB: P49336]
ChEMBL Inhibition of CDK8 in TNF-alpha-induced HEK293 cells by NF-kappaB reporter assay B 8.35 pIC50 4.5 nM IC50 US-20200062728-A1. Quinoline-based compounds and methods of inhibiting cdk8/19 (2020)
ChEMBL Inhibition of CDK8 in TNF-alpha-induced CDK8 and CDK19-knockout HEK293 cells by NF-kappaB reporter assay B 8.47 pIC50 3.4 nM IC50 US-20200062728-A1. Quinoline-based compounds and methods of inhibiting cdk8/19 (2020)
Protein kinase G (PKG) 1/cGMP-dependent protein kinase 1 beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4273] [GtoPdb: 1492] [UniProtKB: Q13976]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
coenzyme Q8A/Chaperone activity of bc1 complex-like, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5550] [GtoPdb: 1927] [UniProtKB: Q8NI60]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Choline-phosphate cytidylyltransferase A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105855] [UniProtKB: P49585]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Chromodomain-helicase-DNA-binding protein 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105742] [UniProtKB: Q14839]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 8.52 pKd 3 nM Kd Science (2017) 358: null-null [PMID:29191878]
citron rho-interacting serine/threonine kinase/Citron Rho-interacting kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5579] [GtoPdb: 1509] [UniProtKB: O14578]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 8/c-Jun N-terminal kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2276] [GtoPdb: 1496] [UniProtKB: P45983]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 9/c-Jun N-terminal kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4179] [GtoPdb: 1497] [UniProtKB: P45984]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 10/c-Jun N-terminal kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2637] [GtoPdb: 1498] [UniProtKB: P53779]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 1/Cyclin-dependent kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL308] [GtoPdb: 1961] [UniProtKB: P06493]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 5.92 pKd 1216 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of CDK1 (unknown origin) B 7.14 pIC50 72 nM IC50 Eur J Med Chem (2016) 110: 291-301 [PMID:26851505]
ChEMBL Inhibition of CDK1 (unknown origin) B 7.92 pIC50 12 nM IC50 Eur J Med Chem (2022) 240: 114603-114603 [PMID:35868123]
ChEMBL Inhibition of CDK1 (unknown origin) by FRET assay B 8.27 pIC50 5.32 nM IC50 Eur J Med Chem (2022) 243: 114704-114704 [PMID:36095992]
GtoPdb - - 8.52 pIC50 3 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of CDK1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillation counting analysis B 8.52 pIC50 3 nM IC50 Bioorg Med Chem (2018) 26: 3491-3501 [PMID:29853338]
ChEMBL Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubated for 1 hr in presence of cyclin by [33P]-ATP-based liquid scintillation counting method B 8.52 pIC50 3 nM IC50 J Med Chem (2019) 62: 4233-4251 [PMID:30543440]
ChEMBL Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr in presence of [33P]ATP by TopCount scintillation counting method B 8.52 pIC50 3 nM IC50 Eur J Med Chem (2019) 172: 143-153 [PMID:30978559]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 Eur J Med Chem (2019) 183: 111641-111641 [PMID:31514062]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 J Med Chem (2020) 63: 13228-13257 [PMID:32866383]
ChEMBL Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incubated for 1 hr in presence of [33P]ATP by liquid scintillation counting method B 8.52 pIC50 3 nM IC50 Eur J Med Chem (2021) 215: 113281-113281 [PMID:33611192]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 Eur J Med Chem (2022) 242: 114701-114701 [PMID:36054949]
ChEMBL Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1 hr in presence of 33P-ATP by liquid scintillation counting analysis B 8.52 pIC50 3 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 Nat Rev Drug Discov (2017) 16: 424-440 [PMID:28280261]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 J Med Chem (2022) 65: 935-954 [PMID:33970631]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 RSC Med Chem (2022) 13: 688-710 [PMID:35814933]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 Eur J Med Chem (2020) 203: 112571-112571 [PMID:32707525]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 J Med Chem (2016) 59: 9305-9320 [PMID:27559828]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 J Med Chem (2023) 66: 7140-7161 [PMID:37234044]
ChEMBL Inhibition of CDK1 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in presence of [gamma33P]ATP by liquid scintillation counter method B 9 pIC50 1 nM IC50 J Med Chem (2021) 64: 14647-14663 [PMID:34477384]
ChEMBL Inhibition of CDK1 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2022) 65: 893-921 [PMID:33539089]
cyclin dependent kinase 12/Cyclin-dependent kinase 12 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3559692] [GtoPdb: 1965] [UniProtKB: Q9NYV4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 7.49 pKd 32 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of CDK12 (unknown origin) B 7.3 pIC50 50 nM IC50 Eur J Med Chem (2022) 240: 114603-114603 [PMID:35868123]
cyclin dependent kinase 13/Cyclin-dependent kinase 13 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1795192] [GtoPdb: 1966] [UniProtKB: Q14004]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 7.68 pKd 21 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 13/Cyclin-dependent kinase 13/Cyclin-K in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL4296067] [GtoPdb: 1966] [UniProtKB: O75909Q14004]
ChEMBL Inhibition of GST-tagged human CDK13/Cyclin K expressed in Sf9 cells using RBER-IRStide peptide as substrate in presence of ATP and [gamma33-P] ATP by radioisotope filter binding assay B 7.68 pIC50 21 nM IC50 J Med Chem (2022) 65: 8881-8896 [PMID:35749742]
cyclin dependent kinase 1/Cyclin-dependent kinase 1/cyclin B in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL2094127] [GtoPdb: 1961] [UniProtKB: O95067P06493P14635Q8WWL7]
ChEMBL Inhibition of CDK1/Cyclin B (unknown origin) assessed as inhibition constant B 8.52 pKi 3 nM Ki Bioorg Med Chem (2023) 80: 117158-117158 [PMID:36706608]
GtoPdb - - 8.52 pIC50 3 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
cyclin dependent kinase 1/Cyclin-dependent kinase 1/cyclin B1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL1907602] [GtoPdb: 1961] [UniProtKB: P06493P14635]
ChEMBL Inhibition of CDK1/Cyclin B (unknown origin) expressed in baculoviral infected insect Sf9 cells using histone H1 as substrate in presence of [gamma-33P]ATP B 7.14 pIC50 72 nM IC50 Eur J Med Chem (2016) 108: 701-719 [PMID:26741853]
ChEMBL Inhibition of His-tagged CDK1/Cyclin-B1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate measured in presence of [gamma-33P]ATP B 7.14 pIC50 72 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 8.52 pIC50 3 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of recombinant CDK1/cyclin B (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrate after 1 hr by gamma32P-ATP based liquid scintillation counting analysis B 8.52 pIC50 3 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
cyclin dependent kinase 2/Cyclin-dependent kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL301] [GtoPdb: 1973] [UniProtKB: P24941]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 7.05 pKd 90 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Binding affinity to CDK2 (unknown origin) by isothermal titration calorimetry B 7.74 pKd 18.4 nM Kd Eur J Med Chem (2021) 216: 113309-113309 [PMID:33711765]
ChEMBL Inhibition of CDK2 (unknown origin) B 7.7 pIC50 20 nM IC50 RSC Med Chem (2023) 14: 734-744 [PMID:37122549]
ChEMBL Inhibition of CDK2 (unknown origin) by western blot assay B 8 pIC50 10 nM IC50 J Med Chem (2021) 64: 2382-2418 [PMID:33650861]
ChEMBL Inhibition of CDK2 (unknown origin) by FRET assay B 8.38 pIC50 4.19 nM IC50 Eur J Med Chem (2022) 243: 114704-114704 [PMID:36095992]
ChEMBL Inhibition of CDK2 (unknown origin) B 8.52 pIC50 <3 nM IC50 Eur J Med Chem (2022) 240: 114603-114603 [PMID:35868123]
GtoPdb Inhibition of CDK2/cyclin E complex. - 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr in presence of [33P]ATP by TopCount scintillation counting method B 9 pIC50 1 nM IC50 Eur J Med Chem (2019) 172: 143-153 [PMID:30978559]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 Eur J Med Chem (2019) 183: 111641-111641 [PMID:31514062]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2020) 63: 13228-13257 [PMID:32866383]
ChEMBL Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incubated for 1 hr in presence of [33P]ATP by liquid scintillation counting method B 9 pIC50 1 nM IC50 Eur J Med Chem (2021) 215: 113281-113281 [PMID:33611192]
ChEMBL Inhibition of human CDK2 B 9 pIC50 1 nM IC50 Eur J Med Chem (2021) 218: 113389-113389 [PMID:33784602]
ChEMBL Inhibition of CDK2 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in presence of [gamma33P]ATP by liquid scintillation counter method B 9 pIC50 1 nM IC50 J Med Chem (2021) 64: 14647-14663 [PMID:34477384]
ChEMBL Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1 hr in presence of 33P-ATP by liquid scintillation counting analysis B 9 pIC50 1 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2022) 65: 893-921 [PMID:33539089]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 RSC Med Chem (2022) 13: 688-710 [PMID:35814933]
ChEMBL Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubated for 1 hr in presence of cyclin by [33P]-ATP-based liquid scintillation counting method B 9 pIC50 1 nM IC50 J Med Chem (2019) 62: 4233-4251 [PMID:30543440]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 Eur J Med Chem (2020) 203: 112571-112571 [PMID:32707525]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2016) 59: 9305-9320 [PMID:27559828]
ChEMBL Inhibition of CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillation counting analysis B 9 pIC50 1 nM IC50 Bioorg Med Chem (2018) 26: 3491-3501 [PMID:29853338]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2023) 66: 7140-7161 [PMID:37234044]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 Eur J Med Chem (2022) 242: 114701-114701 [PMID:36054949]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 Nat Rev Drug Discov (2017) 16: 424-440 [PMID:28280261]
cyclin dependent kinase 2/Cyclin-dependent kinase 2/cyclin E in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL2094126] [GtoPdb: 1973] [UniProtKB: O96020P24864P24941]
ChEMBL Inhibition of CDK2/cyclin E (unknown origin) assessed as inhibition constant B 9 pKi 1 nM Ki Bioorg Med Chem (2023) 80: 117158-117158 [PMID:36706608]
GtoPdb Inhibition of CDK2/cyclin E complex. - 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
cyclin dependent kinase 2/Cyclin-dependent kinase 2/cyclin E1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL1907605] [GtoPdb: 1973] [UniProtKB: P24864P24941]
ChEMBL Inhibition of CDK2/cyclin E (unknown origin) using peptide substrate in presence of [gamma33P]ATP by image analyser B 8.4 pIC50 4 nM IC50 Eur J Med Chem (2021) 216: 113309-113309 [PMID:33711765]
ChEMBL Inhibition of His-tagged CDK2/cyclin E1 (unknown origin) expressed in Sf9 cells using histone H1 as substrate in presence of ATP and [gamma33-P]ATP by radioisotope filter binding assay B 8.52 pIC50 3 nM IC50 J Med Chem (2022) 65: 8881-8896 [PMID:35749742]
ChEMBL Inhibition of CDK2/Cyclin E (unknown origin) expressed in sf9 cells using histone H1 as substrate in presence of [gamma33P]-ATP B 8.7 pIC50 2 nM IC50 Eur J Med Chem (2016) 110: 291-301 [PMID:26851505]
ChEMBL Inhibition of His-tagged CDK2/Cyclin-E1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate measured in presence of [gamma-33P]ATP B 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb Inhibition of CDK2/cyclin E complex. - 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
cyclin dependent kinase 2/Cyclin-dependent kinase 2/G1/S-specific cyclin-D1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL3885552] [GtoPdb: 1973] [UniProtKB: P24385P24941]
ChEMBL Inhibition of GST-tagged CDK2/cyclin D1 (unknown origin) expressed in Sf9 cells using RPPTLSPIPHIPR peptide as substrate in presence of ATP and [gamma33-P] ATP by radioisotope filter binding assay B 6.94 pIC50 115 nM IC50 J Med Chem (2022) 65: 8881-8896 [PMID:35749742]
GtoPdb Inhibition of CDK2/cyclin E complex. - 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
cyclin dependent kinase 3/Cyclin-dependent kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4442] [GtoPdb: 1975] [UniProtKB: Q00526]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 4/Cyclin-dependent kinase 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL331] [GtoPdb: 1976] [UniProtKB: P11802]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 5.94 pKd 1145 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of CDK4 (unknown origin) B 6.9 pIC50 127 nM IC50 Eur J Med Chem (2016) 110: 291-301 [PMID:26851505]
ChEMBL Inhibition of CDK4 (unknown origin) expressed in Sf9 insect cells incubated for 1 hr in presence of [gamma33P]ATP by liquid scintillation counter method B 9 pIC50 1 nM IC50 J Med Chem (2021) 64: 14647-14663 [PMID:34477384]
ChEMBL Inhibition of CDK4 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2022) 65: 893-921 [PMID:33539089]
cyclin dependent kinase 4/Cyclin-dependent kinase 4/cyclin D1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL1907601] [GtoPdb: 1976] [UniProtKB: P11802P24385]
ChEMBL Inhibition of CDK4/Cyclin D1 (unknown origin) using RPPTLSPIPHIPR peptide as substrate in presence of [gamma-33P]ATP B 6.9 pIC50 127 nM IC50 Eur J Med Chem (2016) 108: 701-719 [PMID:26741853]
ChEMBL Inhibition of recombinant human N-terminal GST-fused CDK4 (S4 to E303 residues)/cyclin D1 (Q4 to I295 residues) expressed in baculovirus infected Sf9 insect cells using RPPTLSPIPHIPR as substrate measured in presence of [gamma-33P]ATP B 6.94 pIC50 115 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
cyclin dependent kinase 5/Cyclin-dependent kinase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4036] [GtoPdb: 1977] [UniProtKB: Q00535]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 7.04 pKd 91 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of CDK5 (unknown origin) using histone H1 as substrate in presence of [gamma33P]-ATP B 7.35 pIC50 45 nM IC50 Eur J Med Chem (2016) 110: 291-301 [PMID:26851505]
ChEMBL Inhibition of CDK5 (unknown origin) B 8.3 pIC50 5 nM IC50 RSC Med Chem (2022) 13: 688-710 [PMID:35814933]
ChEMBL Inhibition of CDK5 (unknown origin) by FRET assay B 8.68 pIC50 2.09 nM IC50 Eur J Med Chem (2022) 243: 114704-114704 [PMID:36095992]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillation counting analysis B 9 pIC50 1 nM IC50 Bioorg Med Chem (2018) 26: 3491-3501 [PMID:29853338]
ChEMBL Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubated for 1 hr in presence of cyclin by [33P]-ATP-based liquid scintillation counting method B 9 pIC50 1 nM IC50 J Med Chem (2019) 62: 4233-4251 [PMID:30543440]
ChEMBL Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr in presence of [33P]ATP by TopCount scintillation counting method B 9 pIC50 1 nM IC50 Eur J Med Chem (2019) 172: 143-153 [PMID:30978559]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 Eur J Med Chem (2019) 183: 111641-111641 [PMID:31514062]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2020) 63: 13228-13257 [PMID:32866383]
ChEMBL Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incubated for 1 hr in presence of [33P]ATP by liquid scintillation counting method B 9 pIC50 1 nM IC50 Eur J Med Chem (2021) 215: 113281-113281 [PMID:33611192]
ChEMBL Inhibition of CDK5 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in presence of [gamma33P]ATP by liquid scintillation counter method B 9 pIC50 1 nM IC50 J Med Chem (2021) 64: 14647-14663 [PMID:34477384]
ChEMBL Inhibition of Cdk5 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2022) 65: 893-921 [PMID:33539089]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 Nat Rev Drug Discov (2017) 16: 424-440 [PMID:28280261]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 Eur J Med Chem (2020) 203: 112571-112571 [PMID:32707525]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2016) 59: 9305-9320 [PMID:27559828]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2023) 66: 7140-7161 [PMID:37234044]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 Eur J Med Chem (2022) 242: 114701-114701 [PMID:36054949]
ChEMBL Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1 hr in presence of 33P-ATP by liquid scintillation counting analysis B 9 pIC50 1 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
cyclin dependent kinase 5/Cyclin-dependent kinase 5/CDK5 activator 1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL1907600] [GtoPdb: 1977] [UniProtKB: Q00535Q15078]
ChEMBL Inhibition of recombinant human full-length N-terminal GST-His6 fused CDK5 (M1 to P292 residues)/N-terminal His6-tagged p25 (A104 to R307 residues) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate measured in presence of [gamma-33P]ATP B 7.17 pIC50 67 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
ChEMBL Inhibition of CDK5/p35NCK (unknown origin) using histone H1 as substrate in presence of [gamma-33P]ATP B 7.35 pIC50 45 nM IC50 Eur J Med Chem (2016) 108: 701-719 [PMID:26741853]
ChEMBL Inhibition of Nano-Luc fused human full length CDK5/P35 transfected in HEK293 cells incubated for 1 hr by NanoBRET assay B 7.8 pIC50 16 nM IC50 J Med Chem (2022) 65: 3575-3596 [PMID:35143203]
ChEMBL Inhibition of full length N-terminal GST fused human CDK5(1 to 292 residues)/ p25 (99 to 307 residues) expressed in baculovirus expression system using FL peptide as substrate preincubated for 30 mins followed by substrate addition further incubated for 60 mins by EZ reader method B 8.8 pIC50 1.6 nM IC50 J Med Chem (2022) 65: 3575-3596 [PMID:35143203]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of recombinant CDK5/p25 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrate after 1 hr by gamma32P-ATP based liquid scintillation counting analysis B 9 pIC50 1 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
ChEMBL Inhibition of CDK5/p35 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2022) 65: 6390-6418 [PMID:35485642]
cyclin dependent kinase 6/Cyclin-dependent kinase 6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2508] [GtoPdb: 1978] [UniProtKB: Q00534]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 7.49 pKd 32 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 7/Cyclin-dependent kinase 7 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3055] [GtoPdb: 1979] [UniProtKB: P50613]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.39 pKd 411 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of CDK7 (unknown origin) B 7.38 pIC50 42 nM IC50 Eur J Med Chem (2022) 240: 114603-114603 [PMID:35868123]
cyclin dependent kinase 9/Cyclin-dependent kinase 9 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3116] [GtoPdb: 1981] [UniProtKB: P50750]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 8.15 pKd 7 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of CDK9 (unknown origin) B 6.75 pIC50 178 nM IC50 Eur J Med Chem (2016) 110: 291-301 [PMID:26851505]
ChEMBL Inhibition of recombinant CDK9 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1 hr in presence of 33P-ATP by liquid scintillation counting analysis B 8.4 pIC50 4 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 Nat Rev Drug Discov (2017) 16: 424-440 [PMID:28280261]
ChEMBL Inhibition of CDK9 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillation counting analysis B 8.4 pIC50 4 nM IC50 Bioorg Med Chem (2018) 26: 3491-3501 [PMID:29853338]
ChEMBL Inhibition of recombinant CDK9 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubated for 1 hr in presence of cyclin by [33P]-ATP-based liquid scintillation counting method B 8.4 pIC50 4 nM IC50 J Med Chem (2019) 62: 4233-4251 [PMID:30543440]
ChEMBL Inhibition of recombinant CDK9 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr in presence of [33P]ATP by TopCount scintillation counting method B 8.4 pIC50 4 nM IC50 Eur J Med Chem (2019) 172: 143-153 [PMID:30978559]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 Eur J Med Chem (2019) 183: 111641-111641 [PMID:31514062]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 J Med Chem (2020) 63: 13228-13257 [PMID:32866383]
ChEMBL Inhibition of recombinant CDK9 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incubated for 1 hr in presence of [33P]ATP by liquid scintillation counting method B 8.4 pIC50 4 nM IC50 Eur J Med Chem (2021) 215: 113281-113281 [PMID:33611192]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 Eur J Med Chem (2022) 242: 114701-114701 [PMID:36054949]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 J Med Chem (2016) 59: 9305-9320 [PMID:27559828]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 J Med Chem (2023) 66: 7140-7161 [PMID:37234044]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 RSC Med Chem (2022) 13: 688-710 [PMID:35814933]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 Eur J Med Chem (2020) 203: 112571-112571 [PMID:32707525]
GtoPdb - - 8.4 pIC50 4 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.52 pIC50 <3 nM IC50 Eur J Med Chem (2022) 240: 114603-114603 [PMID:35868123]
ChEMBL Inhibition of CDK9 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in presence of [gamma33P]ATP by liquid scintillation counter method B 9 pIC50 1 nM IC50 J Med Chem (2021) 64: 14647-14663 [PMID:34477384]
cyclin-dependent kinase like 5/Cyclin-dependent kinase-like 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1163112] [GtoPdb: 1986] [UniProtKB: O76039]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Cysteine--tRNA ligase, cytoplasmic in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105937] [UniProtKB: P49589]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Cytochrome c1, heme protein, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105975] [UniProtKB: P08574]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
dCTP pyrophosphatase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3769292] [UniProtKB: Q9H773]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Delta(24)-sterol reductase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2331059] [UniProtKB: Q15392]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Deoxycytidine kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2447] [UniProtKB: P27707]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
discoidin domain receptor tyrosine kinase 2/Discoidin domain-containing receptor 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5122] [GtoPdb: 1844] [UniProtKB: Q16832]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
DnaJ homolog subfamily A member 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2189122] [UniProtKB: P31689]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
DNA replication licensing factor MCM4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105745] [UniProtKB: P33991]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
DNA topoisomerase II alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1806] [GtoPdb: 2637] [UniProtKB: P11388]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
DNA topoisomerase II beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3396] [UniProtKB: Q02880]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase 1/Dual specificity mitogen-activated protein kinase kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3587] [GtoPdb: 2062] [UniProtKB: Q02750]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase 2/Dual specificity mitogen-activated protein kinase kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2964] [GtoPdb: 2063] [UniProtKB: P36507]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase 3/Dual specificity mitogen-activated protein kinase kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2109] [GtoPdb: 2064] [UniProtKB: P46734]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase 4/Dual specificity mitogen-activated protein kinase kinase 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2897] [GtoPdb: 2065] [UniProtKB: P45985]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase 5/Dual specificity mitogen-activated protein kinase kinase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4948] [GtoPdb: 2066] [UniProtKB: Q13163]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase 6/Dual specificity mitogen-activated protein kinase kinase 6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2171] [GtoPdb: 2067] [UniProtKB: P52564]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
CDC like kinase 1/Dual specificity protein kinase CLK1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4224] [GtoPdb: 1990] [UniProtKB: P49759]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.15 pKd 714 nM Kd Science (2017) 358: null-null [PMID:29191878]
CDC like kinase 2/Dual specificity protein kinase CLK2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4225] [GtoPdb: 1991] [UniProtKB: P49760]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
CDC like kinase 4/Dual specificity protein kinase CLK4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4203] [GtoPdb: 1993] [UniProtKB: Q9HAZ1]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
testis associated actin remodelling kinase 1/Dual specificity testis-specific protein kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5604] [GtoPdb: 2239] [UniProtKB: Q15569]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
testis associated actin remodelling kinase 2/Dual specificity testis-specific protein kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2069163] [GtoPdb: 2240] [UniProtKB: Q96S53]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
dual specificity tyrosine phosphorylation regulated kinase 1A/Dual-specificity tyrosine-phosphorylation regulated kinase 1A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2292] [GtoPdb: 2009] [UniProtKB: Q13627]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Dynamin-like 120 kDa protein, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105705] [UniProtKB: O60313]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Electron transfer flavoprotein subunit beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105744] [UniProtKB: P38117]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Elongation factor Tu, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105970] [UniProtKB: P49411]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor A1/Ephrin type-A receptor 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5810] [GtoPdb: 1821] [UniProtKB: P21709]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor A2/Ephrin type-A receptor 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2068] [GtoPdb: 1822] [UniProtKB: P29317]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor A4/Ephrin type-A receptor 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3988] [GtoPdb: 1824] [UniProtKB: P54764]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor A5/Ephrin type-A receptor 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3987] [GtoPdb: 1825] [UniProtKB: P54756]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor A7/Ephrin type-A receptor 7 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4602] [GtoPdb: 1827] [UniProtKB: Q15375]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor B2/Ephrin type-B receptor 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3290] [GtoPdb: 1831] [UniProtKB: P29323]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor B3/Ephrin type-B receptor 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4901] [GtoPdb: 1832] [UniProtKB: P54753]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor B4/Ephrin type-B receptor 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5147] [GtoPdb: 1833] [UniProtKB: P54760]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor B6/Ephrin type-B receptor 6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5836] [GtoPdb: 1834] [UniProtKB: O15197]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
epidermal growth factor receptor/Epidermal growth factor receptor erbB1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL203] [GtoPdb: 1797] [UniProtKB: P00533]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
discoidin domain receptor tyrosine kinase 1/Epithelial discoidin domain-containing receptor 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5319] [GtoPdb: 1843] [UniProtKB: Q08345]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
eukaryotic translation initiation factor 2 alpha kinase 1/Eukaryotic translation initiation factor 2-alpha kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6029] [GtoPdb: 2015] [UniProtKB: Q9BQI3]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Eukaryotic translation initiation factor 5B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105852] [UniProtKB: O60841]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Exosome RNA helicase MTR4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105889] [UniProtKB: P42285]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Ferrochelatase, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3879831] [UniProtKB: P22830]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
fibroblast growth factor receptor 1/Fibroblast growth factor receptor 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3650] [GtoPdb: 1808] [UniProtKB: P11362]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein tyrosine kinase 2/Focal adhesion kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2695] [GtoPdb: 2180] [UniProtKB: Q05397]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
General transcription and DNA repair factor IIH helicase subunit XPD in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105743] [UniProtKB: P18074]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.25 pKd 560 nM Kd Science (2017) 358: null-null [PMID:29191878]
Glycine--tRNA ligase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105815] [UniProtKB: P41250]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
glycogen synthase kinase 3 alpha/Glycogen synthase kinase-3 alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2850] [GtoPdb: 2029] [UniProtKB: P49840]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 5.83 pKd 1475 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of human GSK3A using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate incubated for 2 hrs by [gamma-33P]-ATP assay B 6.38 pIC50 414 nM IC50 J Med Chem (2021) 64: 12548-12571 [PMID:34415148]
glycogen synthase kinase 3 beta/Glycogen synthase kinase-3 beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL262] [GtoPdb: 2030] [UniProtKB: P49841]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 5.84 pKd 1430 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of human GSK3B using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate incubated for 2 hrs by [gamma-33P]-ATP assay B 6.49 pIC50 324 nM IC50 J Med Chem (2021) 64: 12548-12571 [PMID:34415148]
beta adrenergic receptor kinase 1/G-protein coupled receptor kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4079] [GtoPdb: 1466] [UniProtKB: P25098]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
G protein-coupled receptor kinase 6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6144] [GtoPdb: 1470] [UniProtKB: P43250]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
GTP-binding nuclear protein Ran in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1741190] [UniProtKB: P62826]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Guanine nucleotide-binding protein G(i) subunit alpha-2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105887] [UniProtKB: P04899]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Heat shock factor protein 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5869] [UniProtKB: Q00613]
ChEMBL Inhibition of 17AAG-induced HSF1-mediated HSP72 expression in human U2OS cells preincubated for 1 hr followed by 17AAG addition measured after 18 hrs by ELISA B 8.15 pIC50 7 nM IC50 Medchemcomm (2016) 7: 1580-1586 [PMID:27746890]
Haem oxygenase 2/Heme oxygenase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2546] [GtoPdb: 1442] [UniProtKB: P30519]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
MET proto-oncogene, receptor tyrosine kinase/Hepatocyte growth factor receptor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3717] [GtoPdb: 1815] [UniProtKB: P08581]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
inhibitor of nuclear factor kappa B kinase subunit epsilon/Inhibitor of nuclear factor kappa B kinase epsilon subunit in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3529] [GtoPdb: 2040] [UniProtKB: Q14164]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
inosine monophosphate dehydrogenase 2/Inosine-5`-monophosphate dehydrogenase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2002] [GtoPdb: 2625] [UniProtKB: P12268]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Insulin-like growth factor I receptor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1957] [GtoPdb: 1801] [UniProtKB: P08069]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Insulin receptor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1981] [GtoPdb: 1800] [UniProtKB: P06213]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
interleukin 1 receptor associated kinase 1/Interleukin-1 receptor-associated kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3357] [GtoPdb: 2042] [UniProtKB: P51617]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
interleukin 1 receptor associated kinase 3/Interleukin-1 receptor-associated kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5081] [GtoPdb: 2044] [UniProtKB: Q9Y616]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
interleukin 1 receptor associated kinase 4/Interleukin-1 receptor-associated kinase 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3778] [GtoPdb: 2045] [UniProtKB: Q9NWZ3]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Isoleucine--tRNA ligase, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105821] [UniProtKB: Q9NSE4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
LIM domain kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3836] [GtoPdb: 2054] [UniProtKB: P53667]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
LIM domain kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5932] [GtoPdb: 2055] [UniProtKB: P53671]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Liver glycogen phosphorylase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2568] [UniProtKB: P06737]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Long-chain-fatty-acid--CoA ligase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105818] [UniProtKB: Q9ULC5]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
macrophage stimulating 1 receptor/Macrophage-stimulating protein receptor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2689] [GtoPdb: 1816] [UniProtKB: Q04912]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
MAPK activated protein kinase 2/MAP kinase-activated protein kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2208] [GtoPdb: 2094] [UniProtKB: P49137]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
MAPK activated protein kinase 5/MAP kinase-activated protein kinase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3094] [GtoPdb: 2096] [UniProtKB: Q8IW41]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 3/MAP kinase ERK1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3385] [GtoPdb: 1494] [UniProtKB: P27361]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 1/MAP kinase ERK2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4040] [GtoPdb: 1495] [UniProtKB: P28482]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 14/MAP kinase p38 alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL260] [GtoPdb: 1499] [UniProtKB: Q16539]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 11/MAP kinase p38 beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3961] [GtoPdb: 1500] [UniProtKB: Q15759]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
microtubule affinity regulating kinase 2/MAP/microtubule affinity-regulating kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3831] [GtoPdb: 2098] [UniProtKB: Q7KZI7]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
microtubule affinity regulating kinase 4/MAP/microtubule affinity-regulating kinase 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5754] [GtoPdb: 2100] [UniProtKB: Q96L34]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
maternal embryonic leucine zipper kinase/Maternal embryonic leucine zipper kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4578] [GtoPdb: 2102] [UniProtKB: Q14680]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Membrane-associated progesterone receptor component 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105706] [UniProtKB: O00264]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Midasin in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105779] [UniProtKB: Q9NU22]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
misshapen like kinase 1/Misshapen-like kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5518] [GtoPdb: 2103] [UniProtKB: Q8N4C8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 15/Mitogen-activated protein kinase 15 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5198] [GtoPdb: 2090] [UniProtKB: Q8TD08]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 7/Mitogen-activated protein kinase 7 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5332] [GtoPdb: 2093] [UniProtKB: Q13164]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 1/Mitogen-activated protein kinase kinase kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3956] [GtoPdb: 2069] [UniProtKB: Q13233]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 11/Mitogen-activated protein kinase kinase kinase 11 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2708] [GtoPdb: 2071] [UniProtKB: Q16584]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 2/Mitogen-activated protein kinase kinase kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5914] [GtoPdb: 2077] [UniProtKB: Q9Y2U5]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 3/Mitogen-activated protein kinase kinase kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5970] [GtoPdb: 2078] [UniProtKB: Q99759]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 4/Mitogen-activated protein kinase kinase kinase 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4853] [GtoPdb: 2079] [UniProtKB: Q9Y6R4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 5/Mitogen-activated protein kinase kinase kinase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5285] [GtoPdb: 2080] [UniProtKB: Q99683]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 6/Mitogen-activated protein kinase kinase kinase 6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1163123] [GtoPdb: 2081] [UniProtKB: O95382]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase kinase 1/Mitogen-activated protein kinase kinase kinase kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5749] [GtoPdb: 2085] [UniProtKB: Q92918]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase kinase 2/Mitogen-activated protein kinase kinase kinase kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5330] [GtoPdb: 2086] [UniProtKB: Q12851]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase kinase 3/Mitogen-activated protein kinase kinase kinase kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5432] [GtoPdb: 2087] [UniProtKB: Q8IVH8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase kinase 4/Mitogen-activated protein kinase kinase kinase kinase 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6166] [GtoPdb: 2088] [UniProtKB: O95819]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase kinase 5/Mitogen-activated protein kinase kinase kinase kinase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4852] [GtoPdb: 2089] [UniProtKB: Q9Y4K4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
BUB1 mitotic checkpoint serine/threonine kinase/Mitotic checkpoint serine/threonine-protein kinase BUB1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1772932] [GtoPdb: 1949] [UniProtKB: O43683]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ZAK sterile alpha motif and leucine zipper containing kinase AZK/Mixed lineage kinase 7 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3886] [GtoPdb: 2289] [UniProtKB: Q9NYL2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Multifunctional protein ADE2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5922] [UniProtKB: P22234]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Myosin-10 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105746] [UniProtKB: P35580]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Myosin-14 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105888] [UniProtKB: Q7Z406]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
myosin light chain kinase 3/Myosin light chain kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4627] [GtoPdb: 2110] [UniProtKB: Q32MK0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
myosin light chain kinase/Myosin light chain kinase, smooth muscle in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2428] [GtoPdb: 1552] [UniProtKB: Q15746]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105781] [UniProtKB: Q9P0J0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
neurotrophic receptor tyrosine kinase 1/Nerve growth factor receptor Trk-A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2815] [GtoPdb: 1817] [UniProtKB: P04629]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
tyrosine kinase non receptor 1/Non-receptor tyrosine-protein kinase TNK1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5334] [GtoPdb: 2245] [UniProtKB: Q13470]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NUAK family, SNF1-like kinase, 2/NUAK family SNF1-like kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5698] [GtoPdb: 2130] [UniProtKB: Q9H093]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Nucleolar GTP-binding protein 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105780] [UniProtKB: Q9BZE4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Obg-like ATPase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105704] [UniProtKB: Q9NTK5]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
PAS domain containing serine/threonine kinase/PAS domain-containing serine/threonine-protein kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6054] [GtoPdb: 2139] [UniProtKB: Q96RG2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Peroxisomal acyl-coenzyme A oxidase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105748] [UniProtKB: Q15067]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Peroxisomal acyl-coenzyme A oxidase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105817] [UniProtKB: O15254]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Phenylalanine--tRNA ligase beta subunit in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105969] [UniProtKB: Q9NSD9]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Phosphatidylethanolamine-binding protein 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105856] [UniProtKB: P30086]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
phosphatidylinositol-5-phosphate 4-kinase type 2 alpha/Phosphatidylinositol-5-phosphate 4-kinase type-2 alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1795194] [GtoPdb: 2858] [UniProtKB: P48426]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
phosphatidylinositol-5-phosphate 4-kinase type 2 gamma/Phosphatidylinositol-5-phosphate 4-kinase type-2 gamma in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1770034] [GtoPdb: 2163] [UniProtKB: Q8TBX8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Phosphofructokinase platelet type in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2972] [UniProtKB: Q01813]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
phosphorylase kinase catalytic subunit gamma 2/Phosphorylase kinase gamma subunit 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2349] [GtoPdb: 2147] [UniProtKB: P15735]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
platelet derived growth factor receptor beta/Platelet-derived growth factor receptor beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1913] [GtoPdb: 1804] [UniProtKB: P09619]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Probable ATP-dependent RNA helicase DDX6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105783] [UniProtKB: P26196]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase C alpha/Protein kinase C alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL299] [GtoPdb: 1482] [UniProtKB: P17252]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase C beta/Protein kinase C beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3045] [GtoPdb: 1483] [UniProtKB: P05771]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase C delta/Protein kinase C delta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2996] [GtoPdb: 1485] [UniProtKB: Q05655]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase C iota/Protein kinase C iota in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2598] [GtoPdb: 1490] [UniProtKB: P41743]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase D3/Protein kinase C nu in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2595] [GtoPdb: 2174] [UniProtKB: O94806]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase C theta/Protein kinase C theta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3920] [GtoPdb: 1488] [UniProtKB: Q04759]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase C zeta/Protein kinase C zeta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3438] [GtoPdb: 1491] [UniProtKB: Q05513]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase N1/Protein kinase N1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3384] [GtoPdb: 1520] [UniProtKB: Q16512]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase N2/Protein kinase N2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3032] [GtoPdb: 1521] [UniProtKB: Q16513]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein tyrosine kinase 2 beta/Protein tyrosine kinase 2 beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5469] [GtoPdb: 2181] [UniProtKB: Q14289]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
MER proto-oncogene, tyrosine kinase/Proto-oncogene tyrosine-protein kinase MER in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5331] [GtoPdb: 1837] [UniProtKB: Q12866]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Putative heat shock protein HSP 90-beta 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105858] [UniProtKB: Q58FF8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Pyridoxal kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1075181] [UniProtKB: O00764]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Quinone reductase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3959] [UniProtKB: P16083]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Rab-like protein 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105853] [UniProtKB: Q5HYI8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Ras-related protein Rab-10 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105971] [UniProtKB: P61026]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
RAB27A, member RAS oncogene family/Ras-related protein Rab-27A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105702] [GtoPdb: 2916] [UniProtKB: P51159]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Ras-related protein Rab-6A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105703] [UniProtKB: P20340]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
receptor interacting serine/threonine kinase 3/Receptor-interacting serine/threonine-protein kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1795199] [GtoPdb: 2191] [UniProtKB: Q9Y572]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Rho associated coiled-coil containing protein kinase 1/Rho-associated protein kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3231] [GtoPdb: 1503] [UniProtKB: Q13464]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Rho associated coiled-coil containing protein kinase 2/Rho-associated protein kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2973] [GtoPdb: 1504] [UniProtKB: O75116]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ribosomal protein S6 kinase B1/Ribosomal protein S6 kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4501] [GtoPdb: 1525] [UniProtKB: P23443]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ribosomal protein S6 kinase A1/Ribosomal protein S6 kinase alpha 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2553] [GtoPdb: 1527] [UniProtKB: Q15418]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ribosomal protein S6 kinase A3/Ribosomal protein S6 kinase alpha 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2345] [GtoPdb: 1528] [UniProtKB: P51812]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ribosomal protein S6 kinase A4/Ribosomal protein S6 kinase alpha 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3125] [GtoPdb: 1524] [UniProtKB: O75676]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ribosomal protein S6 kinase A5/Ribosomal protein S6 kinase alpha 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4237] [GtoPdb: 1523] [UniProtKB: O75582]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ribosomal protein S6 kinase A6/Ribosomal protein S6 kinase alpha 6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4924] [GtoPdb: 1530] [UniProtKB: Q9UK32]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
RNA cytidine acetyltransferase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105935] [UniProtKB: Q9H0A0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
S-adenosylmethionine synthase isoform type-2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3313835] [UniProtKB: P31153]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Septin-9 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105891] [UniProtKB: Q9UHD8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ATR checkpoint kinase/Serine-protein kinase ATR in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5024] [GtoPdb: 1935] [UniProtKB: Q13535]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine kinase 10/Serine/threonine-protein kinase 10 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3981] [GtoPdb: 2211] [UniProtKB: O94804]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine kinase 11/Serine/threonine-protein kinase 11 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5606] [GtoPdb: 2212] [UniProtKB: Q15831]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.3 pKd 497 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine kinase 16/Serine/threonine-protein kinase 16 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3938] [GtoPdb: 2213] [UniProtKB: O75716]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
STE20 like kinase/Serine/threonine-protein kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4202] [GtoPdb: 2200] [UniProtKB: Q9H2G2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine kinase 24/Serine/threonine-protein kinase 24 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5082] [GtoPdb: 2217] [UniProtKB: Q9Y6E0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Serine/threonine kinase 38 like/Serine/threonine-protein kinase 38-like in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4851] [GtoPdb: 1518] [UniProtKB: Q9Y2H1]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
AKT serine/threonine kinase 1/Serine/threonine-protein kinase AKT in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4282] [GtoPdb: 1479] [UniProtKB: P31749]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
AKT serine/threonine kinase 2/Serine/threonine-protein kinase AKT2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2431] [GtoPdb: 1480] [UniProtKB: P31751]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
AKT serine/threonine kinase 3/Serine/threonine-protein kinase AKT3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4816] [GtoPdb: 2286] [UniProtKB: Q9Y243]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
A-Raf proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase A-Raf in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1169596] [GtoPdb: 1933] [UniProtKB: P10398]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
aurora kinase A/Serine/threonine-protein kinase Aurora-A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4722] [GtoPdb: 1936] [UniProtKB: O14965]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
aurora kinase B/Serine/threonine-protein kinase Aurora-B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2185] [GtoPdb: 1937] [UniProtKB: Q96GD4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
B-Raf proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase B-raf in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5145] [GtoPdb: 1943] [UniProtKB: P15056]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
checkpoint kinase 1/Serine/threonine-protein kinase Chk1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4630] [GtoPdb: 1987] [UniProtKB: O14757]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
microtubule affinity regulating kinase 3/Serine/threonine-protein kinase c-TAK1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5600] [GtoPdb: 2099] [UniProtKB: P27448]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase D2/Serine/threonine-protein kinase D2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4900] [GtoPdb: 2173] [UniProtKB: Q9BZL6]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
endoplasmic reticulum to nucleus signaling 1/Serine/threonine-protein kinase/endoribonuclease IRE1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1163101] [GtoPdb: 2020] [UniProtKB: O75460]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
endoplasmic reticulum to nucleus signaling 2/Serine/threonine-protein kinase/endoribonuclease IRE2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105932] [GtoPdb: 2021] [UniProtKB: Q76MJ5]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin G associated kinase/Serine/threonine-protein kinase GAK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4355] [GtoPdb: 2027] [UniProtKB: O14976]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ciliogenesis associated kinase 1/Serine/threonine-protein kinase ICK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1163126] [GtoPdb: 2038] [UniProtKB: Q9UPZ9]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.57 pKd 271 nM Kd Science (2017) 358: null-null [PMID:29191878]
integrin linked kinase/Serine/threonine-protein kinase ILK-1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5247] [GtoPdb: 2041] [UniProtKB: Q13418]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
large tumor suppressor kinase 1/Serine/threonine-protein kinase LATS1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6167] [GtoPdb: 1515] [UniProtKB: O95835]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
CDC42 binding protein kinase alpha/Serine/threonine-protein kinase MRCK-A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4516] [GtoPdb: 1507] [UniProtKB: Q5VT25]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
CDC42 binding protein kinase beta/Serine/threonine-protein kinase MRCK beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5052] [GtoPdb: 1508] [UniProtKB: Q9Y5S2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
CDC42 binding protein kinase gamma/Serine/threonine-protein kinase MRCK gamma in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5615] [GtoPdb: 1506] [UniProtKB: Q6DT37]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine kinase 4/Serine/threonine-protein kinase MST1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4598] [GtoPdb: 2225] [UniProtKB: Q13043]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine kinase 3/Serine/threonine-protein kinase MST2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4708] [GtoPdb: 2219] [UniProtKB: Q13188]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine-protein kinase MST4/Serine/threonine-protein kinase MST4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5941] [GtoPdb: 2287] [UniProtKB: Q9P289]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 7.01 pKd 98 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase N3/Serine/threonine-protein kinase N3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3627581] [GtoPdb: 1522] [UniProtKB: Q6P5Z2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NIMA related kinase 1/Serine/threonine-protein kinase Nek1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5855] [GtoPdb: 2114] [UniProtKB: Q96PY6]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NIMA related kinase 2/Serine/threonine-protein kinase NEK2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3835] [GtoPdb: 2117] [UniProtKB: P51955]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NIMA related kinase 3/Serine/threonine-protein kinase Nek3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5679] [GtoPdb: 2118] [UniProtKB: P51956]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NIMA related kinase 7/Serine/threonine-protein kinase NEK7 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4849] [GtoPdb: 2122] [UniProtKB: Q8TDX7]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NIMA related kinase 9/Serine/threonine-protein kinase NEK9 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5257] [GtoPdb: 2124] [UniProtKB: Q8TD19]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
nemo like kinase/Serine/threonine protein kinase NLK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5364] [GtoPdb: 2125] [UniProtKB: Q9UBE8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
p21 (RAC1) activated kinase 2/Serine/threonine-protein kinase PAK 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4487] [GtoPdb: 2134] [UniProtKB: Q13177]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
p21 (RAC1) activated kinase 4/Serine/threonine-protein kinase PAK 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4482] [GtoPdb: 2136] [UniProtKB: O96013]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
p21 (RAC1) activated kinase 6/Serine/threonine-protein kinase PAK6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4311] [GtoPdb: 2137] [UniProtKB: Q9NQU5]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 16/Serine/threonine-protein kinase PCTAIRE-1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4597] [GtoPdb: 1969] [UniProtKB: Q00536]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.9 pKd 125 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 17/Serine/threonine-protein kinase PCTAIRE-2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5790] [GtoPdb: 1970] [UniProtKB: Q00537]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.11 pKd 778 nM Kd Science (2017) 358: null-null [PMID:29191878]
Pim-1 proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase PIM1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2147] [GtoPdb: 2158] [UniProtKB: P11309]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Pim-2 proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase PIM2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4523] [GtoPdb: 2159] [UniProtKB: Q9P1W9]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
polo like kinase 4/Serine/threonine-protein kinase PLK4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3788] [GtoPdb: 2171] [UniProtKB: O00444]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
receptor interacting serine/threonine kinase 2/Serine/threonine-protein kinase RIPK2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5014] [GtoPdb: 2190] [UniProtKB: O43353]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
salt inducible kinase 2/Serine/threonine-protein kinase SIK2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5699] [GtoPdb: 2198] [UniProtKB: Q9H0K1]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
SIK family kinase 3/Serine/threonine-protein kinase SIK3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6149] [GtoPdb: 2199] [UniProtKB: Q9Y2K2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
TAO kinase 1/Serine/threonine-protein kinase TAO1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5261] [GtoPdb: 2233] [UniProtKB: Q7L7X3]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.75 pKd 17866 nM Kd Science (2017) 358: null-null [PMID:29191878]
TAO kinase 2/Serine/threonine-protein kinase TAO2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1075195] [GtoPdb: 2234] [UniProtKB: Q9UL54]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 5.65 pKd 2233 nM Kd Science (2017) 358: null-null [PMID:29191878]
TAO kinase 3/Serine/threonine-protein kinase TAO3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5701] [GtoPdb: 2235] [UniProtKB: Q9H2K8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 5.61 pKd 2439 nM Kd Science (2017) 358: null-null [PMID:29191878]
TANK binding kinase 1/Serine/threonine-protein kinase TBK1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5408] [GtoPdb: 2237] [UniProtKB: Q9UHD2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
unc-51 like autophagy activating kinase 1/Serine/threonine-protein kinase ULK1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6006] [GtoPdb: 2271] [UniProtKB: O75385]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
unc-51 like kinase 3/Serine/threonine-protein kinase ULK3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5047] [GtoPdb: 2273] [UniProtKB: Q6PHR2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
WEE1 G2 checkpoint kinase/Serine/threonine-protein kinase WEE1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5491] [GtoPdb: 2278] [UniProtKB: P30291]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Signal recognition particle receptor subunit alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105934] [UniProtKB: P08240]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
STE20 related adaptor alpha/STE20-related kinase adapter protein alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1795198] [GtoPdb: 2227] [UniProtKB: Q7RTN6]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Structural maintenance of chromosomes protein 1A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105747] [UniProtKB: Q14683]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Structural maintenance of chromosomes protein 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105890] [UniProtKB: O95347]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105973] [UniProtKB: Q9P2R7]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
transforming growth factor beta receptor 1/TGF-beta receptor type I in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4439] [GtoPdb: 1788] [UniProtKB: P36897]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
transforming growth factor beta receptor 2/TGF-beta receptor type II in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4267] [GtoPdb: 1795] [UniProtKB: P37173]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Thyroid hormone receptor-associated protein 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105820] [UniProtKB: Q9Y2W1]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
TP53 regulating kinase/TP53-regulating kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1938223] [GtoPdb: 2248] [UniProtKB: Q96S44]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
TRAF2 and NCK interacting kinase/TRAF2- and NCK-interacting kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4527] [GtoPdb: 2244] [UniProtKB: Q9UKE5]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase, membrane associated tyrosine/threonine 1/Tyrosine- and threonine-specific cdc2-inhibitory kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3984] [GtoPdb: 2167] [UniProtKB: Q99640]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
tyrosine kinase non receptor 2/Tyrosine kinase non-receptor protein 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4599] [GtoPdb: 2246] [UniProtKB: Q07912]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ABL proto-oncogene 1, non-receptor tyrosine kinase/Tyrosine-protein kinase ABL in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1862] [GtoPdb: 1923] [UniProtKB: P00519]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ABL proto-oncogene 2, non-receptor tyrosine kinase/Tyrosine-protein kinase ABL2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4014] [GtoPdb: 1924] [UniProtKB: P42684]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein tyrosine kinase 6/Tyrosine-protein kinase BRK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4601] [GtoPdb: 2182] [UniProtKB: Q13882]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Bruton tyrosine kinase/Tyrosine-protein kinase BTK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5251] [GtoPdb: 1948] [UniProtKB: Q06187]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
C-terminal Src kinase/Tyrosine-protein kinase CSK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2634] [GtoPdb: 1994] [UniProtKB: P41240]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
FER tyrosine kinase/Tyrosine-protein kinase FER in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3982] [GtoPdb: 2022] [UniProtKB: P16591]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
FES proto-oncogene, tyrosine kinase/Tyrosine-protein kinase FES in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5455] [GtoPdb: 2023] [UniProtKB: P07332]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
fyn related Src family tyrosine kinase/Tyrosine-protein kinase FRK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4223] [GtoPdb: 2025] [UniProtKB: P42685]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
FYN proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase FYN in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1841] [GtoPdb: 2026] [UniProtKB: P06241]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
HCK proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase HCK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3234] [GtoPdb: 2032] [UniProtKB: P08631]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Janus kinase 1/Tyrosine-protein kinase JAK1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2835] [GtoPdb: 2047] [UniProtKB: P23458]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
LCK proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase LCK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL258] [GtoPdb: 2053] [UniProtKB: P06239]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
LYN proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase Lyn in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3905] [GtoPdb: 2060] [UniProtKB: P07948]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
fms related receptor tyrosine kinase 3/Tyrosine-protein kinase receptor FLT3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1974] [GtoPdb: 1807] [UniProtKB: P36888]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of human FLT3 ITD mutant using EAIYAAPFAKKK as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method B 5.7 pIC50 >2000 nM IC50 J Med Chem (2021) 64: 10981-10996 [PMID:34288692]
ret proto-oncogene/Tyrosine-protein kinase receptor RET in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2041] [GtoPdb: 2185] [UniProtKB: P07949]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
SRC proto-oncogene, non-receptor tyrosine kinase/Tyrosine-protein kinase SRC in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL267] [GtoPdb: 2206] [UniProtKB: P12931]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
spleen associated tyrosine kinase/Tyrosine-protein kinase SYK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2599] [GtoPdb: 2230] [UniProtKB: P43405]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
tec protein tyrosine kinase/Tyrosine-protein kinase TEC in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4246] [GtoPdb: 2238] [UniProtKB: P42680]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
tyrosine kinase 2/Tyrosine-protein kinase TYK2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3553] [GtoPdb: 2269] [UniProtKB: P29597]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
YES proto-oncogene 1, Src family tyrosine kinase/Tyrosine-protein kinase YES in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2073] [GtoPdb: 2284] [UniProtKB: P07947]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Tyrosyl-tRNA synthetase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3179] [UniProtKB: P54577]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
U5 small nuclear ribonucleoprotein 200 kDa helicase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105972] [UniProtKB: O75643]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
UMP-CMP kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5681] [UniProtKB: P30085]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
aarF domain containing kinase 1/Uncharacterized aarF domain-containing protein kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105885] [GtoPdb: 1925] [UniProtKB: Q86TW2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
aarF domain containing kinase 5/Uncharacterized aarF domain-containing protein kinase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105886] [GtoPdb: 1929] [UniProtKB: Q3MIX3]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Uncharacterized protein FLJ45252 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105933] [UniProtKB: Q6ZSR9]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Very long-chain specific acyl-CoA dehydrogenase, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105892] [UniProtKB: P49748]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]

ChEMBL data shown on this page come from version 35:

Zdrazil B, Felix E, Hunter F, Manners EJ, Blackshaw J, Corbett S, de Veij M, Ioannidis H, Lopez DM, Mosquera JF, Magarinos MP, Bosc N, Arcila R, Kizilören T, Gaulton A, Bento AP, Adasme MF, Monecke P, Landrum GA, Leach AR. (2024). The ChEMBL Database in 2023: a drug discovery platform spanning multiple bioactivity data types and time periods. Nucleic Acids Res., 52(D1). DOI: 10.1093/nar/gkad1004. [EPMCID:10767899] [PMID:37933841]
Davies M, Nowotka M, Papadatos G, Dedman N, Gaulton A, Atkinson F, Bellis L, Overington JP. (2015) 'ChEMBL web services: streamlining access to drug discovery data and utilities.' Nucleic Acids Res., 43(W1). DOI: 10.1093/nar/gkv352. [EPMCID:25883136]