CCL5   Click here for help

GtoPdb Ligand ID: 758

Synonyms: eosinophil chemotactic cytokine [EoCP] | regulated upon activation normal T cell expressed and secreted (RANTES)
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: CCL5 (also known as RANTES- an acronym for regulated on activation, normal T cell expressed and secreted) is a CC family chemokine, that has HIV suppressive activity, as do the related CD8+ T cell chemokines CCL3 and CCL4.
Species: Human
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Ser-Pro-Tyr-Ser-Ser-Asp-Thr-Thr-Pro-Cys-Cys-Phe-Ala-Tyr-Ile-Ala-Arg-Pro-Leu-Pro-Arg-Ala-His-Ile-Lys-Glu-Tyr-Phe-Tyr-Thr-Ser-Gly-Lys-Cys-Ser-Asn-Pro-Ala-Val-Val-Phe-Val-Thr-Arg-Lys-Asn-Arg-Gln-Val-Cys-Ala-Asn-Pro-Glu-Lys-Lys-Trp-Val-Arg-Glu-Tyr-Ile-Asn-Ser-Leu-Glu-Met-Ser
Post-translational Modification
2 N-terminally truncated forms are found (RANTES(3-68) and RANTES(4-68) ). Also, these forms together with RANTES include post-translational glycosylation of amino acids at position 27 and 28.