CCL4   

GtoPdb Ligand ID: 757

Synonyms: HC21 | macrophage inflammatory protein-1β | MIP-1β
Comment: CCL4 is a CC family chemokine more commonly referred to as macrophage inflammatory protein-1β or MIP-1β. It acts in a dimer with CCL3 (MIP-1α) [1].
Species: Human
Peptide Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Ala-Pro-Met-Gly-Ser-Asp-Pro-Pro-Thr-Ala-Cys-Cys-Phe-Ser-Tyr-Thr-Ala-Arg-Lys-Leu-Pro-Arg-Asn-Phe-Val-Val-Asp-Tyr-Tyr-Glu-Thr-Ser-Ser-Leu-Cys-Ser-Gln-Pro-Ala-Val-Val-Phe-Gln-Thr-Lys-Arg-Ser-Lys-Gln-Val-Cys-Ala-Asp-Pro-Ser-Glu-Ser-Trp-Val-Gln-Glu-Tyr-Val-Tyr-Asp-Leu-Glu-Leu-Asn
Selected 3D Structures
PDB Id: 1HUM
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
1 N-terminally truncated form is found (MIP-1-beta(3-69) )