Abbreviated name: GLP-2 (3-33)
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Mouse GLP-2(3-33) is different from human at residues 9 (Serine) and 17 (Threonine) and from rat at one residue in position 9 (Serine).
GLP-2(3-33) is the result of N-terminal dipeptide proteolytic cleavage of GLP-2(1-33) by serine protease dipeptidyl peptidase IV. GLP-2(3-33) is able to interact with GLP-2 receptors even though it remains unclear whether GLP-2(3-33) has a biological activity in vivo or may affect the biological activity of GLP-2(1-33) [1]
Species: Mouse
|
Peptide Sequence | |
DGSFSDEMSTILDNLATRDFINWLIQTKITD | |
Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Ser-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp |
Download 2D Structure | |
Canonical SMILES | Download |
Isomeric SMILES | Download |
InChI standard identifier | Download |
InChI standard key | Download |
Molecular structure representations generated using Open Babel