IFN-α16   

GtoPdb Ligand ID: 4958

Synonyms: IFN alpha-16 | interferon alpha-16 | interferon alpha-WA
Comment: IFN-α16 is a type I IFN.
Species: Human
Peptide Sequence
CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAFHEMIQQTFNLFSTKDSSAAWDET
LLDKFYIELFQQLNDLEACVTQEVGVEEIALMNEDSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQK
GLRRKD
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 1 and 99, and 29 and 139