nogapendekin alfa 
GtoPdb Ligand ID: 11594
|
Synonyms: IL15 D72
Compound class:
Peptide or derivative
Comment: Inogapendekin alfa is recombinant human IL-15 with an amino acid substitution (Asn72Asp/N72D) that enhances its agonist activity at the IL-15Rβγc complex. IL-15N72D increases biological activity by 4-5-fold compared to the wild type cytokine. Inogapendekin alfa is synthesised in tandem with inbakicept to generate the clinical stage IL-15 superagonist complex ALT-803.
|
Peptide Sequence  |
|
|
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNV TESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
|
This work is licensed under a Creative Commons Attribution-ShareAlike 4.0 International License