protoxin II   Click here for help

GtoPdb Ligand ID: 7571

Synonyms: β/ω-theraphotoxin-Tp2a | β/ω-TRTX-Tp2a | protoxin-2 | ProTx-2 | ProTx-II | ProTx2 | PT-II
Compound class: Peptide
Comment: Toxin from Thrixopelma pruriens (Peruvian green velvet tarantula).
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
YCQKWMWTCDSERKCCEGMVCRLWCKKKLW
Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Lys-Leu-Trp
Post-translational Modification
Disulphide bonds between cysteine residues at positions 2 and 16, 9 and 21, and 15 and 25.