GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

α-scorpion toxin 2   Click here for help

GtoPdb Ligand ID: 2618

Synonyms: α-mammal toxin Lqh2 | Lqh II | LqhII | LqTx-2
Compound class: Peptide
Comment: Toxin from Leiurus quinquestriatus hebraeus (Yellow scorpion).
Click here for help
Peptide Sequence Click here for help
IKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCR
Ile-Lys-Asp-Gly-Tyr-Ile-Val-Asp-Asp-Val-Asn-Cys-Thr-Tyr-Phe-Cys-Gly-Arg-Asn-Ala-Tyr-Cys-Asn-Glu-Glu-Cys-Thr-Lys-Leu-Lys-Gly-Glu-Ser-Gly-Tyr-Cys-Gln-Trp-Ala-Ser-Pro-Tyr-Gly-Asn-Ala-Cys-Tyr-Cys-Tyr-Lys-Leu-Pro-Asp-His-Val-Arg-Thr-Lys-Gly-Pro-Gly-Arg-Cys-Arg
Post-translational Modification
Residue one is arginine amide; predicated disulphide bond formation between cysteine residues at positions 12 and 63, 16 and 36, 22 and 46, and 26 and 48.