Synonyms: ZP-1848 | ZP1848
Compound class:
Peptide or derivative
Comment: Glepaglutide (ZP1848, Zealand Pharma) is a long-acting human glucagon like peptide-2 (GLP-2) analogue with a C-terminal hexa-lysine addition.
The wild type peptide sequence is HADGSFSDEMNTILDNLAARDFINWLIQTKITD, compared to the glepaglutide sequence which is HGEGTFSSELATILDALAARDFIAWLIATKITDKKKKKK (the hexa-lysine is inderlined). GLP-2 receptor agonists have therapeutic potential in clinical indications with compromised absorptive capacity at the intestinal mucosa, such as in short bowel syndrome. GLP2 analogues have been designed to be less susceptible to enzymatic cleavage and renal clearance and hence have an improved circulating half-life compared to the endogenous peptide. Teduglutide is already approved but has a once-daily injection regimen, so longer-acting analogues are still of development interest. |
Classification | |
Compound class | Peptide or derivative |
International Nonproprietary Names | |
INN number | INN |
10481 | glepaglutide |
Synonyms |
ZP-1848 | ZP1848 |
Database Links | |
CAS Registry No. | 914009-86-2 (source: WHO INN record) |
GtoPdb PubChem SID | 405560326 |
PubChem CID | 146170995 |
Search Google for chemical match using the InChIKey | DOAUQKRTILFGHV-PDCMDPCFSA-N |
Search Google for chemicals with the same backbone | DOAUQKRTILFGHV |
Search PubMed clinical trials | glepaglutide |
Search PubMed titles | glepaglutide |
Search PubMed titles/abstracts | glepaglutide |
UniChem Compound Search for chemical match using the InChIKey | DOAUQKRTILFGHV-PDCMDPCFSA-N |
UniChem Connectivity Search for chemical match using the InChIKey | DOAUQKRTILFGHV-PDCMDPCFSA-N |