CCL3   Click here for help

GtoPdb Ligand ID: 756

Synonyms: macrophage inflammatory protein-1α | MIP-1α
Immunopharmacology Ligand
Comment: CCL3 is a CC family chemokine more commonly referred to as macrophage inflammatory protein-1α or MIP-1α. It acts in a dimer with CCL4 (MIP-1β) [1].
Species: Human
Click here for help
Peptide Sequence Click here for help
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Ser-Leu-Ala-Ala-Asp-Thr-Pro-Thr-Ala-Cys-Cys-Phe-Ser-Tyr-Thr-Ser-Arg-Gln-Ile-Pro-Gln-Asn-Phe-Ile-Ala-Asp-Tyr-Phe-Glu-Thr-Ser-Ser-Gln-Cys-Ser-Lys-Pro-Gly-Val-Ile-Phe-Leu-Thr-Lys-Arg-Ser-Arg-Gln-Val-Cys-Ala-Asp-Pro-Ser-Glu-Glu-Trp-Val-Gln-Lys-Tyr-Val-Ser-Asp-Leu-Glu-Leu-Ser-Ala
Selected 3D Structures
PDB Id: 1B53
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
1 N-terminally truncated form is found (MIP-1-alpha(4-69))