GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-23A   Click here for help

GtoPdb Ligand ID: 4989

Synonyms: IL-23p19 | IL23A | interleukin-23 subunit alpha | interleukin-23A
Immunopharmacology Ligand
Comment: IL-23 is a heterodimeric cytokine, sharing a common p40 subunit with IL-12, but having a unique p19 subunit (IL23A).
Species: Human
Is a component of
Peptide Sequence Click here for help
RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIF
YEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARV
FAHGAATLSP