growth/differentiation factor-6   Click here for help

GtoPdb Ligand ID: 4878

Abbreviated name: GDF6
Synonyms: BMP13 | bone morphogenetic protein 13 | GDF-6 | growth/differentiation factor 16
Compound class: Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer. May signal through BMPR1A, BMPR1B, BMPR2 and ActR2 [1].
Species: Human
Peptide Sequence Click here for help
TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGST
PPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
Post-translational Modification
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 84 of each chain. Predicted disulphide bond formation between cysteine residues at positions 19 and 85, 48 and 117, and 52 and 119