CCL4

Ligand id: 4410

Name: CCL4

Species: Mouse

Peptide Sequence
APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Ala-Pro-Met-Gly-Ser-Asp-Pro-Pro-Thr-Ser-Cys-Cys-Phe-Ser-Tyr-Thr-Ser-Arg-Gln-Leu-His-Arg-Ser-Phe-Val-Met-Asp-Tyr-Tyr-Glu-Thr-Ser-Ser-Leu-Cys-Ser-Lys-Pro-Ala-Val-Val-Phe-Leu-Thr-Lys-Arg-Gly-Arg-Gln-Ile-Cys-Ala-Asn-Pro-Ser-Glu-Pro-Trp-Val-Thr-Glu-Tyr-Met-Ser-Asp-Leu-Glu-Leu-Asn