Synonyms: Acthar® | adrenocorticotropic hormone (1-39) | corticotropin
ACTH is an approved drug (FDA (1950))
Compound class:
Endogenous peptide in human, mouse or rat
Comment: This is an enodgenous peptide secreted by the pituitary gland and is one of the peptide products of the POMC gene. It stimulates secretion of glucocorticoid steroid hormones. ACTH is used as a drug with the INN corticotropin. ACTH is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress.
Species: Human
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖View more information in the IUPHAR Pharmacology Education Project: acth |
Peptide Sequence | |
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF | |
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
Post-translational Modification | |
None. |
Download 2D Structure | |
Canonical SMILES | Download |
Isomeric SMILES | Download |
InChI standard identifier | Download |
InChI standard key | Download |
Molecular structure representations generated using Open Babel