norrin   Click here for help

GtoPdb Ligand ID: 2947

Compound class: Endogenous peptide in human, mouse or rat
Comment: Norrin: is the protein product of the Norrie disease gene NDP, is a secreted protein whose biochemical function is not yet fully understood. This protein is highly homologous to the human sequence and is conserved in rat.
Species: Mouse
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
KTDSSFLMDSQRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKAL
RLRCSGGMRLTATYRYILSCHCEECSS
Lys-Thr-Asp-Ser-Ser-Phe-Leu-Met-Asp-Ser-Gln-Arg-Cys-Met-Arg-His-His-Tyr-Val-Asp-Ser-Ile-Ser-His-Pro-Leu-Tyr-Lys-Cys-Ser-Ser-Lys-Met-Val-Leu-Leu-Ala-Arg-Cys-Glu-Gly-His-Cys-Ser-Gln-Ala-Ser-Arg-Ser-Glu-Pro-Leu-Val-Ser-Phe-Ser-Thr-Val-Leu-Lys-Gln-Pro-Phe-Arg-Ser-Ser-Cys-His-Cys-Cys-Arg-Pro-Gln-Thr-Ser-Lys-Leu-Lys-Ala-Leu-Arg-Leu-Arg-Cys-Ser-Gly-Gly-Met-Arg-Leu-Thr-Ala-Thr-Tyr-Arg-Tyr-Ile-Leu-Ser-Cys-His-Cys-Glu-Glu-Cys-Ser-Ser
Post-translational Modification
Disulfide bonds formed between cysteine residues at positions 13 and 70; 29 and 84; 39 and 100; 43 and 102