norrin   Click here for help

GtoPdb Ligand ID: 2947

Comment: Norrin: is the protein product of the Norrie disease gene NDP, is a secreted protein whose biochemical function is not yet fully understood. This protein is highly homologous to the human sequence and is conserved in rat.
Species: Mouse
Click here for help
Peptide Sequence Click here for help
KTDSSFLMDSQRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKAL
RLRCSGGMRLTATYRYILSCHCEECSS
Lys-Thr-Asp-Ser-Ser-Phe-Leu-Met-Asp-Ser-Gln-Arg-Cys-Met-Arg-His-His-Tyr-Val-Asp-Ser-Ile-Ser-His-Pro-Leu-Tyr-Lys-Cys-Ser-Ser-Lys-Met-Val-Leu-Leu-Ala-Arg-Cys-Glu-Gly-His-Cys-Ser-Gln-Ala-Ser-Arg-Ser-Glu-Pro-Leu-Val-Ser-Phe-Ser-Thr-Val-Leu-Lys-Gln-Pro-Phe-Arg-Ser-Ser-Cys-His-Cys-Cys-Arg-Pro-Gln-Thr-Ser-Lys-Leu-Lys-Ala-Leu-Arg-Leu-Arg-Cys-Ser-Gly-Gly-Met-Arg-Leu-Thr-Ala-Thr-Tyr-Arg-Tyr-Ile-Leu-Ser-Cys-His-Cys-Glu-Glu-Cys-Ser-Ser
Post-translational Modification
Disulfide bonds formed between cysteine residues at positions 13 and 70; 29 and 84; 39 and 100; 43 and 102