peptide YY   Click here for help

GtoPdb Ligand ID: 1514

Abbreviated name: PYY
Synonyms: peptide tyrosine tyrosine
Compound class: Endogenous peptide in human, mouse or rat
Comment: Peptide YY is a neuropeptide Y2 receptor agonist. It has been investigated as a potential appetite suppressant [2,6,8-9].
Species: Human
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species

IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: peptide yy

Peptide Sequence Click here for help
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Post-translational Modification
The C-terminal tyrosine is amidated.