Synonyms: antimicrobial peptide-57 | colon-derived SUSD2 binding factor
Compound class:
Endogenous peptide in human, mouse or rat
Comment: This peptide is a product of the human C10orf99 gene. It is proposed as an agonistic ligand of the orphan GPCR, GPR15, and has been referred to as GPR15L [1]. Structurally, GPR15L is predicted to contain two intramolecular disulphide bonds, which implies a similarity to CC family cytokines.
GPR15L has also been reported as a pruritogen that is produced in the skin, which induces mast cell degranulation via activation of the Mas-related G protein-coupled receptors (MRGPRs) [2]. MRGPR-GPR15L-mediated itch and inflammation is independent of GPR15.
Species: Human
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence | |
MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQ V |
|
H-Lys-Arg-Arg-Pro-Ala-Lys-Ala-Trp-Ser-Gly-Arg-Arg-Thr-Arg-Leu-Cys(1)-Cys(2)-His-Arg-Val-Pro-Ser-Pro-Asn-Ser-Thr-Asn-Leu-Lys-Gly-His-His-Val-Arg-Leu-Cys(2)-Lys-Pro-Cys(1)-Lys-Leu-Glu-Pro-Glu-Pro-Arg-Leu-Trp-Val-Val-Pro-Gly-Ala-Leu-Pro-Gln-Val-OH |
Post-translational Modification | |
Amino acids 1-24 (MRLLVLSSLLCILLLCFSIFSTEG) represent a signal peptide and have been removed to show the mature peptide sequence in the 3 letter code. |
Download 2D Structure | |
Canonical SMILES | Download |
Isomeric SMILES | Download |
Molecular structure representations generated using Open Babel