GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CXCL10   Click here for help

GtoPdb Ligand ID: 835

Immunopharmacology Ligand
Comment: CXCL10 is a C-X-C motif chemokine preferentially expressed by Th1 lymphocytes. It exerts its biological effects via interaction with the CXCR3 GPCR.
Species: Human
Click here for help
Peptide Sequence Click here for help
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Val-Pro-Leu-Ser-Arg-Thr-Val-Arg-Cys-Thr-Cys-Ile-Ser-Ile-Ser-Asn-Gln-Pro-Val-Asn-Pro-Arg-Ser-Leu-Glu-Lys-Leu-Glu-Ile-Ile-Pro-Ala-Ser-Gln-Phe-Cys-Pro-Arg-Val-Glu-Ile-Ile-Ala-Thr-Met-Lys-Lys-Lys-Gly-Glu-Lys-Arg-Cys-Leu-Asn-Pro-Glu-Ser-Lys-Ala-Ile-Lys-Asn-Leu-Leu-Lys-Ala-Val-Ser-Lys-Glu-Arg-Ser-Lys-Arg-Ser-Pro