GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: IL-23p19 | IL23A | interleukin-23 subunit alpha | interleukin-23A
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IL-23 is a heterodimeric cytokine, sharing a common p40 subunit with IL-12, but having a unique p19 subunit (IL23A).
Species: Human
|
| Is a component of |
| IL-23 |
Peptide Sequence ![]() |
|
|
RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIF YEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARV FAHGAATLSP |
|