GSK2334470 [Ligand Id: 8008] activity data from GtoPdb and ChEMBL

Click here for a description of the charts and data table

Please tell us if you are using this feature and what you think!

ChEMBL ligand: CHEMBL1765740
  • 3-phosphoinositide dependent protein kinase 1/3-phosphoinositide-dependent protein kinase 1 in Human [ChEMBL: CHEMBL2534] [GtoPdb: 1519] [UniProtKB: O15530]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • epidermal growth factor receptor/Epidermal growth factor receptor in Human [ChEMBL: CHEMBL203] [GtoPdb: 1797] [UniProtKB: P00533]
There should be some charts here, you may need to enable JavaScript!
  • glycogen synthase kinase 3 beta/Glycogen synthase kinase-3 beta in Human [ChEMBL: CHEMBL262] [GtoPdb: 2030] [UniProtKB: P49841]
There should be some charts here, you may need to enable JavaScript!
  • component of inhibitor of nuclear factor kappa B kinase complex/Inhibitor of nuclear factor kappa-B kinase subunit alpha in Human [ChEMBL: CHEMBL3476] [GtoPdb: 1989] [UniProtKB: O15111]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase kinase 5/Mitogen-activated protein kinase kinase kinase 5 in Human [ChEMBL: CHEMBL5285] [GtoPdb: 2080] [UniProtKB: Q99683]
There should be some charts here, you may need to enable JavaScript!
  • phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma/Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform in Human [ChEMBL: CHEMBL3267] [GtoPdb: 2156] [UniProtKB: P48736]
There should be some charts here, you may need to enable JavaScript!
  • pyruvate dehydrogenase kinase 1/[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial in Human [ChEMBL: CHEMBL4766] [GtoPdb: 2915] [UniProtKB: Q15118]
There should be some charts here, you may need to enable JavaScript!
  • AKT serine/threonine kinase 1/RAC-alpha serine/threonine-protein kinase in Human [ChEMBL: CHEMBL4282] [GtoPdb: 1479] [UniProtKB: P31749]
There should be some charts here, you may need to enable JavaScript!
  • Rho associated coiled-coil containing protein kinase 1/Rho-associated protein kinase 1 in Human [ChEMBL: CHEMBL3231] [GtoPdb: 1503] [UniProtKB: Q13464]
There should be some charts here, you may need to enable JavaScript!
  • transforming growth factor beta receptor 1/TGF-beta receptor type-1 in Human [ChEMBL: CHEMBL4439] [GtoPdb: 1788] [UniProtKB: P36897]
There should be some charts here, you may need to enable JavaScript!
  • spleen associated tyrosine kinase/Tyrosine-protein kinase SYK in Human [ChEMBL: CHEMBL2599] [GtoPdb: 2230] [UniProtKB: P43405]
There should be some charts here, you may need to enable JavaScript!
  • kinase insert domain receptor/Vascular endothelial growth factor receptor 2 in Human [ChEMBL: CHEMBL279] [GtoPdb: 1813] [UniProtKB: P35968]
There should be some charts here, you may need to enable JavaScript!
DB Assay description Assay Type Standard value Standard parameter Original value Original units Original parameter Reference
3-phosphoinositide dependent protein kinase 1/3-phosphoinositide-dependent protein kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2534] [GtoPdb: 1519] [UniProtKB: O15530]
ChEMBL Inhibition of PDK1-mediated RSK phosphorylation at Ser221 residue in human PC3 cells by ELISA B 6.53 pIC50 293 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Inhibition of PDK1-mediated AKT phosphorylation at Thr308 residue in human PC3 cells by ELISA B 6.95 pIC50 113 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Affinity Phenotypic Cellular interaction (ELISA (phosphorylation of Thr308-AKT (PI3K-dependent) in PC-3 cells)) EUB0000153b PDPK1 B 6.95 pIC50 113 nM IC50 Affinity Phenotypic Cellular Literature for EUbOPEN Chemogenomics Library wave 3
ChEMBL Inhibition of recombinant full length PDK1 (unknown origin) expressed in insect cells assessed as inhibition of Akt activation measured for 30 mins in presence of [gamma32P-ATP] B 8 pIC50 10 nM IC50 J Med Chem (2013) 56: 2726-2737 [PMID:23448267]
ChEMBL Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence-based spectrophotometry B 8 pIC50 10 nM IC50 J Med Chem (2011) 54: 8490-8500 [PMID:22040023]
ChEMBL Inhibition of PDK1 B 8.6 pIC50 2.51 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
GtoPdb - - 8.6 pIC50 2.51 nM IC50 J Med Chem (2011) 54: 1871-95 [PMID:21341675]
ChEMBL Inhibition of PDK1 (unknown origin) B 8.6 pIC50 2.5 nM IC50 Eur J Med Chem (2016) 118: 47-63 [PMID:27123901]
ChEMBL Inhibition of PDK1 B 8.6 pIC50 2.5 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Affinity Biochemical interaction (Enzymatic inhibition assay) EUB0000153b PDPK1 B 8.6 pIC50 2.5 nM IC50 Affinity Biochemical Literature for EUbOPEN Chemogenomics Library wave 3
aurora kinase A/Aurora kinase A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4722] [GtoPdb: 1936] [UniProtKB: O14965]
ChEMBL Inhibition of aurora A B 4.4 pIC50 39810 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
GtoPdb - - 5 pIC50 >10000 nM IC50 J Med Chem (2011) 54: 1871-95 [PMID:21341675]
ChEMBL Inhibition of aurora A B 5 pIC50 >10000 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Selectivity interaction (Kinase panel (enzymatic assay)) EUB0000153b STK6 B 5 pIC50 >10000 nM IC50 Selectivity Literature for EUbOPEN Chemogenomics Library wave 3
aurora kinase B/Aurora kinase B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2185] [GtoPdb: 1937] [UniProtKB: Q96GD4]
ChEMBL Inhibition of aurora B B 5.5 pIC50 3162.28 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
GtoPdb - - 5.5 pIC50 3160 nM IC50 J Med Chem (2011) 54: 1871-95 [PMID:21341675]
ChEMBL Inhibition of aurora B B 5.5 pIC50 3162 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Selectivity interaction (Kinase panel (enzymatic assay)) EUB0000153b AURKB B 5.5 pIC50 3162 nM IC50 Selectivity Literature for EUbOPEN Chemogenomics Library wave 3
epidermal growth factor receptor/Epidermal growth factor receptor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL203] [GtoPdb: 1797] [UniProtKB: P00533]
ChEMBL Inhibition of EGFR B 5 pIC50 >10000 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Selectivity interaction (Kinase panel (enzymatic assay)) EUB0000153b EGFR B 5 pIC50 >10000 nM IC50 Selectivity Literature for EUbOPEN Chemogenomics Library wave 3
glycogen synthase kinase 3 beta/Glycogen synthase kinase-3 beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL262] [GtoPdb: 2030] [UniProtKB: P49841]
ChEMBL Inhibition of GSK3B B 4.6 pIC50 >25118 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Selectivity interaction (Kinase panel (enzymatic assay)) EUB0000153b GSK3B B 5 pIC50 >10000 nM IC50 Selectivity Literature for EUbOPEN Chemogenomics Library wave 3
component of inhibitor of nuclear factor kappa B kinase complex/Inhibitor of nuclear factor kappa-B kinase subunit alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3476] [GtoPdb: 1989] [UniProtKB: O15111]
ChEMBL Inhibition of IKK1 B 4.6 pIC50 >25118 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Selectivity interaction (Kinase panel (enzymatic assay)) EUB0000153b CHUK B 5 pIC50 >10000 nM IC50 Selectivity Literature for EUbOPEN Chemogenomics Library wave 3
mitogen-activated protein kinase kinase kinase 5/Mitogen-activated protein kinase kinase kinase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5285] [GtoPdb: 2080] [UniProtKB: Q99683]
ChEMBL Inhibition of ASK1 B 4.56 pIC50 >27542 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Selectivity interaction (Kinase panel (enzymatic assay)) EUB0000153b MAP3K5 B 5 pIC50 >10000 nM IC50 Selectivity Literature for EUbOPEN Chemogenomics Library wave 3
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma/Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3267] [GtoPdb: 2156] [UniProtKB: P48736]
ChEMBL Inhibition of PI3Kgamma B 4.6 pIC50 25118 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Selectivity interaction (Kinase panel (enzymatic assay)) EUB0000153b PIK3CG B 5 pIC50 >10000 nM IC50 Selectivity Literature for EUbOPEN Chemogenomics Library wave 3
pyruvate dehydrogenase kinase 1/[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4766] [GtoPdb: 2915] [UniProtKB: Q15118]
ChEMBL Inhibition of PDK1 (unknown origin) B 8 pIC50 10 nM IC50 Eur J Med Chem (2023) 246: 114971-114971 [PMID:36462440]
ChEMBL Selectivity interaction (Kinase panel (enzymatic assay)) EUB0000153b PDK1 B 8.6 pIC50 2.5 nM IC50 Selectivity Literature for EUbOPEN Chemogenomics Library wave 3
AKT serine/threonine kinase 1/RAC-alpha serine/threonine-protein kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4282] [GtoPdb: 1479] [UniProtKB: P31749]
ChEMBL Inhibition of AKT1 B 5 pIC50 >10000 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Selectivity interaction (Kinase panel (enzymatic assay)) EUB0000153b AKT1 B 5 pIC50 >10000 nM IC50 Selectivity Literature for EUbOPEN Chemogenomics Library wave 3
Rho associated coiled-coil containing protein kinase 1/Rho-associated protein kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3231] [GtoPdb: 1503] [UniProtKB: Q13464]
ChEMBL Inhibition of ROCK1 B 5.1 pIC50 7943.28 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Inhibition of ROCK1 B 5.1 pIC50 7943 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Selectivity interaction (Kinase panel (enzymatic assay)) EUB0000153b ROCK1 B 5.1 pIC50 7943 nM IC50 Selectivity Literature for EUbOPEN Chemogenomics Library wave 3
transforming growth factor beta receptor 1/TGF-beta receptor type-1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4439] [GtoPdb: 1788] [UniProtKB: P36897]
ChEMBL Inhibition of ALK5 B 5 pIC50 >10000 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Inhibition of ALK5 B 5 pIC50 >10000 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Selectivity interaction (Kinase panel (enzymatic assay)) EUB0000153b TGFBR1 B 5 pIC50 >10000 nM IC50 Selectivity Literature for EUbOPEN Chemogenomics Library wave 3
spleen associated tyrosine kinase/Tyrosine-protein kinase SYK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2599] [GtoPdb: 2230] [UniProtKB: P43405]
ChEMBL Inhibition of SYK B 4.6 pIC50 >25118 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Selectivity interaction (Kinase panel (enzymatic assay)) EUB0000153b SYK B 5 pIC50 >10000 nM IC50 Selectivity Literature for EUbOPEN Chemogenomics Library wave 3
kinase insert domain receptor/Vascular endothelial growth factor receptor 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL279] [GtoPdb: 1813] [UniProtKB: P35968]
ChEMBL Inhibition of VEGFR2 B 5 pIC50 >10000 nM IC50 J Med Chem (2011) 54: 1871-1895 [PMID:21341675]
ChEMBL Selectivity interaction (Kinase panel (enzymatic assay)) EUB0000153b KDR B 5 pIC50 >10000 nM IC50 Selectivity Literature for EUbOPEN Chemogenomics Library wave 3

ChEMBL data shown on this page come from version 36:

Zdrazil B, Felix E, Hunter F, Manners EJ, Blackshaw J, Corbett S, de Veij M, Ioannidis H, Lopez DM, Mosquera JF, Magarinos MP, Bosc N, Arcila R, Kizilören T, Gaulton A, Bento AP, Adasme MF, Monecke P, Landrum GA, Leach AR. (2024). The ChEMBL Database in 2023: a drug discovery platform spanning multiple bioactivity data types and time periods. Nucleic Acids Res., 52(D1). DOI: 10.1093/nar/gkad1004. [EPMCID:10767899] [PMID:37933841]
Davies M, Nowotka M, Papadatos G, Dedman N, Gaulton A, Atkinson F, Bellis L, Overington JP. (2015) 'ChEMBL web services: streamlining access to drug discovery data and utilities.' Nucleic Acids Res., 43(W1). DOI: 10.1093/nar/gkv352. [EPMCID:25883136]