Abbreviated name: LEAP2
Compound class:
Endogenous peptide in human, mouse or rat
Comment: LEAP2 is an endogenous peptide with antimicrobial properties, that is part of the humoral immune response to microbes. It is expressed in the liver. LEAP2 has also been identified as an endogenous antagonist of the appetite-stimulatory hormone, ghrelin, that is secreted in the stomach and which acts via the pituitary/hypothalamic ghrelin receptor (growth hormone secretagogue receptor, or GHSR) [1].
Species: Human
![]() Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence ![]() |
|
MWHLKLCAVLMIFLLLLGQIDGSPIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE |
Post-translational Modification | |
Residues 1-22 are a signal peptide, and residues 23-37 is cleaved leaving amino acids 38-77 to form the mature peptide. Two disulphide bonds between Cys54and Cys65 and Cys60 and Cys70. |