GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CCL17   Click here for help

GtoPdb Ligand ID: 797

Synonyms: TARC | thymus- and activation-regulated chemokine
Immunopharmacology Ligand
Comment: CCL17 is a CC family cytokine.
Species: Human
Click here for help
Peptide Sequence Click here for help
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Ala-Arg-Gly-Thr-Asn-Val-Gly-Arg-Glu-Cys-Cys-Leu-Glu-Tyr-Phe-Lys-Gly-Ala-Ile-ProLeu-Arg-Lys-Leu-Lys-Thr-Trp-Tyr-Gln-Thr-Ser-Glu-Asp-Cys-Ser-Arg-Asp-Ala-Ile-Val-Phe-Val-Thr-Val-Gln-Gly-Arg-Ala-Ile-Cys-Ser-Asp-Pro-Asn-Asn-Lys-Arg-Val-Lys-Asn-Ala-Val-Lys-Tyr-Leu-Gln-Ser-Leu-Glu-Arg-Ser
Selected 3D Structures
PDB Id: 1NR2
Image of ligand 3D structure from RCSB PDB