CCL26

Ligand id: 776

Name: CCL26

Species: Human

Peptide Sequence
TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Thr-Arg-Gly-Ser-Asp-Ile-Ser-Lys-Thr-Cys-Cys-Phe-Gln-Tyr-Ser-His-Lys-Pro-Leu-Pro-Trp-Thr-Trp-Val-Arg-Ser-Tyr-Glu-Phe-Thr-Ser-Asn-Ser-Cys-Ser-Gln-Arg-Ala-Val-Ile-Phe-Thr-Thr-Lys-Arg-Gly-Lys-Lys-Val-Cys-Thr-His-Pro-Arg-Lys-Lys-Trp-Val-Gln-Lys-Tyr-Ile-Ser-Leu-Leu-Lys-Thr-Pro-Lys-Gln-Leu
Selected 3D Structures
PDB Id: 1G2S
Image of ligand 3D structure from RCSB PDB