GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

belatacept   Click here for help

GtoPdb Ligand ID: 6892

Synonyms: BMS-224818 | LEA29Y | Nulojix®
Approved drug Immunopharmacology Ligand
belatacept is an approved drug (FDA (2011), EMA (2011))
Compound class: Peptide
Comment: A recombinant protein fusing the extracellular domain of human cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4) to the modified Fc (hinge, CH2, and CH3 domains) portion of human immunoglobulin G1 (IgG1). CTLA-4 is essential for T-cell co-activation.
Belatecept differs from abatacept by only 2 amino acids.
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: belatacept

Peptide Sequence Click here for help
MHVAQPAVVLASSRGIASFVCEYASPGKYTEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQ
GLRAMDTGLYICKVELMYPPPYYEGIGNGTQIYVIDPEPCPDSDQEPKSSDKTHTSPPSPAPELLGGSSVFLFPPKPKDT
LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA
PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL
TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Chemical Modification
The drug is a dimeric protein, consisting of two identical subunits linked by a disulphide bridge (between Cys120 on each subunit). The sequence shown above is for a single monomer. Intra-subunit disulphide bridges form between cysteines 21-92, 48-66, 171-231 and 277-335. There are glycosylation sites at Asn76, Asn108, Ser129, Ser139 and Asn207. This additional structural information is taken from the INN record for the drug.