Synonyms: activin beta-C chain | inhibin beta C chain
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
|
Peptide Sequence | |
GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSC CVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS |
Post-translational Modification | |
Predicted to form an active peptide homo or heterodimer through association with alpha or beta subunits, linked by one or more disulphide bonds. Predicted interchain disulphide bond formation between cysteine residues at positions 80; predicted disulphide bond formation between cysteine resisdues at positions 4 and 12, 11 and 81, 40 and 113, and 44 and 115 |