GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

inhibin α   Click here for help

GtoPdb Ligand ID: 5005

Synonyms: inhibin alpha chain
Species: Human
Is a component of
Peptide Sequence Click here for help
STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPP
TPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI
Post-translational Modification
Forms a dimer with either inhibin beta-A (forming Inhibin A) or inhibin beta-B (forming Inhibin B). N-linked glycosylation of asparagine residue at position 36; partial N-linked glycosylation at position 70. Predicted disulphide bond formation between cysteine resdiues at positions 30 and 96, 59 and 131, and 63 and 133. Predicted interchain disulphide bond formation between cysteine resdiues at position 95