Synonyms: inhibin alpha chain
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
|
Is a component of |
inhibin A |
inhibin B |
Peptide Sequence ![]() |
|
STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPP TPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI |
Post-translational Modification | |
Forms a dimer with either inhibin beta-A (forming Inhibin A) or inhibin beta-B (forming Inhibin B). N-linked glycosylation of asparagine residue at position 36; partial N-linked glycosylation at position 70. Predicted disulphide bond formation between cysteine resdiues at positions 30 and 96, 59 and 131, and 63 and 133. Predicted interchain disulphide bond formation between cysteine resdiues at position 95 |