GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: interferon kappa
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IFN-κ is a type I IFN.
Species: Human
|
Peptide Sequence ![]() |
|
LDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWK ERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVR VEIRRCLYYFYKFTALFRRK |
Post-translational Modification | |
Predicted disulphide bond formation between cysteine residues at positions 3 and 101, and 32 and 154 |