GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-κ   Click here for help

GtoPdb Ligand ID: 4969

Synonyms: interferon kappa
Immunopharmacology Ligand
Comment: IFN-κ is a type I IFN.
Species: Human
Peptide Sequence Click here for help
LDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWK
ERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVR
VEIRRCLYYFYKFTALFRRK
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 3 and 101, and 32 and 154