GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: IFN-alpha-8 | interferon alpha-8 | interferon alpha-B | interferon alpha-B2
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IFN-α8 is a type I IFN.
Species: Human
|
Peptide Sequence ![]() |
|
CDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFEFPQEEFDDKQFQKAQAISVLHEMIQQTFNLFSTKDSSAALDET LLDEFYIELDQQLNDLESCVMQEVGVIESPLMYEDSILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQK RLKSKE |
Post-translational Modification | |
Predicted disulphide bond formation between cysteine residues at positions 1 and 99, and 29 and 139 |