GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-α4   Click here for help

GtoPdb Ligand ID: 4962

Synonyms: IFN-alpha-4 | interferon alpha-4  | interferon alpha-4B | interferon alpha-76 | interferon alpha-M1
Immunopharmacology Ligand
Comment: IFN-α4 is a type I IFN.
Species: Human
Peptide Sequence Click here for help
CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFGFPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQS
LLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQK
RLRRKD
Post-translational Modification
Predicted disulphide bond fromation between cysteine residues at positions 1 and 99, and 29 and 166