GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: IFN-alpha-4 | interferon alpha-4 | interferon alpha-4B | interferon alpha-76 | interferon alpha-M1
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IFN-α4 is a type I IFN.
Species: Human
|
Peptide Sequence ![]() |
|
CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFGFPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQS LLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQK RLRRKD |
Post-translational Modification | |
Predicted disulphide bond fromation between cysteine residues at positions 1 and 99, and 29 and 166 |