GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: DT-R
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
|
Peptide Sequence ![]() |
|
DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGER CHGLSL |
Selected 3D Structures | ||
|
Post-translational Modification | |
O-linked glycosylation of threonine residues at positions 13 and 23; predicted disulphide bond formation between cysteine residues at positions 46 and 59, 54 and 70, and 72 and 81 |