GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

growth/differentiation factor-9   Click here for help

GtoPdb Ligand ID: 4939

Abbreviated name: GDF9
Synonyms: GDF-9
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
Peptide Sequence Click here for help
GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVH
TMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR
Post-translational Modification
The active peptide is predicted to be either a homodimer or a heterodimer, which cannot be disulphide linked. Predicted N-linked glycosylation of asparagine residue at position 19; predicted disulphide bond formation between cysteine residues at positions 34 and 100, 63 and 132, and 67 and 134