CXCL9

Ligand id: 4429

Name: CXCL9

Species: Mouse

Peptide Sequence
TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRG
KKHQKNMKNRKPKTPQSRRRSRKTT
Thr-Leu-Val-Ile-Arg-Asn-Ala-Arg-Cys-Ser-Cys-Ile-Ser-Thr-Ser-Arg-Gly-Thr-Ile-His-Tyr-Lys-Ser-Leu-Lys-Asp-Leu-Lys-Gln-Phe-Ala-Pro-Ser-Pro-Asn-Cys-Asn-Lys-Thr-Glu-Ile-Ile-Ala-Thr-Leu-Lys-Asn-Gly-Asp-Gln-Thr-Cys-Leu-Asp-Pro-Asp-Ser-Ala-Asn-Val-Lys-Lys-Leu-Met-Lys-Glu-Trp-Glu-Lys-Lys-Ile-Asn-Gln-Lys-Lys-Lys-Gln-Lys-Arg-Gly-Lys-Lys-His-Gln-Lys-Asn-Met-Lys-Asn-Arg-Lys-Pro-Lys-Thr-Pro-Gln-Ser-Arg-Arg-Arg-Ser-Arg-Lys-Thr-Thr