CXCL1   

GtoPdb Ligand ID: 4423

Comment: This is the mouse homolog of human CXCL1.
Species: Mouse
Peptide Sequence
APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Ala-Pro-Ile-Ala-Asn-Glu-Leu-Arg-Cys-Gln-Cys-Leu-Gln-Thr-Met-Ala-Gly-Ile-His-Leu-Lys-Asn-Ile-Gln-Ser-Leu-Lys-Val-Leu-Pro-Ser-Gly-Pro-His-Cys-Thr-Gln-Thr-Glu-Val-Ile-Ala-Thr-Leu-Lys-Asn-Gly-Arg-Glu-Ala-Cys-Leu-Asp-Pro-Glu-Ala-Pro-Leu-Val-Gln-Lys-Ile-Val-Gln-Lys-Met-Leu-Lys-Gly-Val-Pro-Lys