iPep-SARS2-E 
GtoPdb Ligand ID: 13253
|
Synonyms: TAT-MY18-2ED [1]
Compound class:
Peptide or derivative
Comment: This is a small cell-penetrating peptide that targets coronavirus envelope (E) protein [1]. The first 13 amino acids represent a sequence that facilitates membrane penetration. Amino acids 14-31 are derived from the N-terminal (and extraviral) region of E protein, with Glu7 and Glu8 replaced by Asp residues. Experimental evidence suggests that iPep-SARS2-E integrates into SARS-CoV-2 E protein oligomers and reduces the E-mediated channel current in HEK cells.
|
Peptide Sequence  |
|
| GRKKRRQRRRPPQMYSFVSDDTGTLIVNSVL | |
This work is licensed under a Creative Commons Attribution-ShareAlike 4.0 International License