sotatercept   Click here for help

GtoPdb Ligand ID: 12962

Synonyms: ACE-011 | ACE011 | ActRIIA-IgG1 | MK-7962 | MK7962 | sotatercept-csrk | Winrevair®
Approved drug
sotatercept is an approved drug (FDA (2024))
Compound class: Antibody
Comment: Sotatercept (MK-7962) is a soluble activin receptor 2A (ACVR2A; ActR2) ligand trap type inhibitor. Structurally it is a fusion protein of the extracellular domain of the ActR2 and a human IgG Fc domain. In pulmonary blood vessels sotatercept sequesters ActR2 endogenous ligands (e.g. activins A and B, and growth differentiation factors 8 and 11, BMP6 and BMP7), and prevents their interaction with ActR2s to restore normal cell proliferation [2,6].
Peptide Sequence Click here for help
ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEV
YFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQP
REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF
SCSVMHEALHNHYTQKSLSLSPGK
Chemical Modification
Dimer linked by two inter-chain disulphide bonds.