GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CCL13   Click here for help

GtoPdb Ligand ID: 770

Synonyms: monocyte chemotactic protein-4
Immunopharmacology Ligand
Comment: CCL13 is a CC chemokine.
Species: Human
Click here for help
Peptide Sequence Click here for help
FNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTL
KT
Phe-Asn-Pro-Gln-Gly-Leu-Ala-Gln-Pro-Asp-Ala-Leu-Asn-Val-Pro-Ser-Thr-Cys-Cys-Phe-Thr-Phe-Ser-Ser-Lys-Lys-Ile-Ser-Leu-Gln-Arg-Leu-Lys-Ser-Tyr-Val-Ile-Thr-Thr-Ser-Arg-Cys-Pro-Gln-Lys-Ala-Val-Ile-Phe-Arg-Thr-Lys-Leu-Gly-Lys-Glu-Ile-Cys-Ala-Asp-Pro-Lys-Glu-Lys-Trp-Val-Gln-Asn-Tyr-Met-Lys-His-Leu-Gly-Arg-Lys-Ala-His-Thr-Leu-Lys-Thr
Selected 3D Structures
PDB Id: 2RA4
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
2 N-terminally cleaved forms have been identified to exist in low abundance.