GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

TL1A   Click here for help

GtoPdb Ligand ID: 5071

Synonyms: Tumor necrosis factor ligand superfamily member 15, membrane form
Immunopharmacology Ligand
Comment: TL1A occurs as both membrane‐bound and soluble forms. It principally functions as a negative modulator of epithelial cell proliferation.
Inhibiting the TL1A/death receptor 3 (TNFRSF25) pathway has been proposed as mechanism to treat inflammatory bowel disease [1]. In addition, TL1A has been associated with tumourigenesis and progression of some gastrointestinal malignancies [3,5,9], making it a target of interest for the development of novel anti-cancer drugs, and profibrotic processes.
TL1A is also an endogenous ligand for decoy receptor 3 (DcR3; TNFRSF6B).
Species: Human
Peptide Sequence Click here for help
MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPS
HQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTS
ECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTK
EDKTFFGAFLL
Selected 3D Structures
PDB Id: 2O0O
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 133 and 229; disulphide bond formation between cysteine residues at positions 162 and 202