GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-γ   Click here for help

GtoPdb Ligand ID: 4968

Synonyms: Actimmune® | immune interferon | interferon gamma
Approved drug Immunopharmacology Ligand
IFN-γ is an approved drug (FDA (1999))
Comment: IFN-γ is a type II interferon. It is biologically active as a homodimer.
Species: Human
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: interferon-gamma (ifn-γ)

Peptide Sequence Click here for help
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVK
FFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Selected 3D Structures
PDB Id: 1FG9
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Residue one is pyrrrolidine carboxylic acid; N linked glycosylation of asparagine residue at position 25; N-linked glycosylation of asparagine at position 97 in the dimeric form