A8Δ71-73   Click here for help

GtoPdb Ligand ID: 5780

Comment: Synthetic analogue of a mutated form of C5a [1].
Click here for help
Peptide Sequence Click here for help
TLQKKIEEIAAKYKHSVVKKCCYDGAAVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISFKRS
Thr-Leu-Gln-Lys-Lys-Ile-Glu-Glu-Ile-Ala-Ala-Lys-Tyr-Lys-His-Ser-Val-Val-Lys-Lys-Cys-Cys-Tyr-Asp-Gly-Ala-Ala-Val-Asn-Asn-Asp-Glu-Thr-Cys-Glu-Gln-Arg-Ala-Ala-Arg-Ile-Ser-Leu-Gly-Pro-Arg-Cys-Ile-Lys-Ala-Phe-Thr-Glu-Cys-Cys-Val-Val-Ala-Ser-Gln-Leu-Arg-Ala-Asn-Ile-Ser-Phe-Lys-Arg-Ser
Chemical Modification
The natural sequence of C5a is C-terminally truncated (residues 71-74 are removed). Cysteine residue at position 27 of the natural sequence of C5a is replaced with alanine, histidine residue at position 67 is replaced with phenylalanine, aspartic acid residue at position 69 is replaced with arginine and methionine residue at position 70 is replaced with serine.