muscarinic toxin 2   Click here for help

GtoPdb Ligand ID: 312

Synonyms: MT2 | MTx2
Compound class: Peptide
Comment: MT2 (m4-toxin), like MT7 (ml-toxin), is a toxin from the venom of the Eastern green mamba (Dendroaspis augusticeps).
Click here for help
Peptide Sequence Click here for help
LTCVTTKSIGGVTTEDCPAGQNVCFKRWHYVTPKNYDIIKGCAATCPKVDNNDPIRCCGTDKCND
Leu-Thr-Cys-Val-Thr-Thr-Lys-Ser-Ile-Gly-Gly-Val-Thr-Thr-Glu-Asp-Cys-Pro-Ala-Gly-Gln-Asn-Val-Cys-Phe-Lys-Arg-Trp-His-Tyr-Val-Thr-Pro-Lys-Asn-Tyr-Asp-Ile-Ile-Lys-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Lys-Val-Asp-Asn-Asn-Asp-Pro-Ile-Arg-Cys-Cys-Gly-Thr-Asp-Lys-Cys-Asn-Asp
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 2 and 24, 17 and 42, 46 and 57 and 58 and 63