SNG001   Click here for help

GtoPdb Ligand ID: 11129

Immunopharmacology Ligand
Comment: SNG001 is a recombinant form of human interferon β, interferon beta-1a, in a formulation that can be administered via a neubliser, directly to the lungs. Synairgen originally developed SNG001 as a therapy for virally-induced exacerbations of COPD, but have rapidly re-deployed it for SARS-CoV-2 infection. The EU Clinical Trials Register entry for Synairgen's study of SNG001 in COVID-19 patients (EudraCT Number: 2020-001023-14) contains the detail that SNG001 is "Interferon beta-1a".
Peptide Sequence Click here for help
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN
ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL
TGYLRN
Chemical Modification
Disulphide bridge between Cys31-Cys141.