GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CXCL12φ   Click here for help

GtoPdb Ligand ID: 8533

Immunopharmacology Ligand
Comment: Protein product of a splice variant of the CXCL12 gene. Identification of CXCL12φ is reported in [1], although its biological significance remsins unclear.
Species: Human
Peptide Sequence Click here for help
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKIWLYGNAETSR
Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-Ile-Trp-Leu-Tyr-Gly-Asn-Ala-Glu-Thr-Ser-Arg