GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

Met-Ckβ7   Click here for help

GtoPdb Ligand ID: 788

Synonyms: Ckβ7 | Met-chemokine β 7
Compound class: Peptide
Comment: Synthetic analogue of human CCL18. This synthetic peptide has an amino acid substitution at the N-terminus. The reference states that a C-terminally-extended variant produced as a result of a frameshift mutation (ending in LKLMPEA) showed identical antagonist activity to the structure shown here
Click here for help
Peptide Sequence Click here for help
MQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Met-Gln-Val-Gly-Thr-Asn-Lys-Glu-Leu-Cys-Cys-Leu-Val-Tyr-Thr-Ser-Trp-Gln-Ile-Pro-Gln-Lys-Phe-Ile-Val-Asp-Tyr-Ser-Glu-Thr-Ser-Pro-Gln-Cys-Pro-Lys-Pro-Gly-Val-Ile-Leu-Leu-Thr-Lys-Arg-Gly-Arg-Gln-Ile-Cys-Ala-Asp-Pro-Asn-Lys-Lys-Trp-Val-Gln-Lys-Tyr-Ile-Ser-Asp-Leu-Lys-Leu-Asn-Ala
Chemical Modification
N-terminal alanine residue of the natural sequence of CCL18 is replaced with methionine