CCL24   Click here for help

GtoPdb Ligand ID: 775

Synonyms: eotaxin-2
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: CCL24 is a CC family chemokine. It can promote recruitment and activation of both immune cells and fibroblasts and this combined action induces over-production of extracellular matrix components that underlie uncontrolled inflammation and fibrotic changes. Based on evidence that CCL24 is a driver of inflammation and fibrosis in human diseases such as primary sclerosing cholangitis (PSC) [2], systemic sclerosis, metabolic dysfunction-associated steatotic liver disease (MASLD) and metabolic dysfunction-associated steatohepatitis (MASH) it is being investigated as a therapeutic target for these types of disease.
Species: Human
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVK
GPVQRYPGNQTTC
Val-Val-Ile-Pro-Ser-Pro-Cys-Cys-Met-Phe-Phe-Val-Ser-Lys-Arg-Ile-Pro-Glu-Asn-Arg-Val-Val-Ser-Tyr-Gln-Leu-Ser-Ser-Arg-Ser-Thr-Cys-Leu-Lys-Ala-Gly-Val-Ile-Phe-Thr-Thr-Lys-Lys-Gly-Gln-Gln-Phe-Cys-Gly-Asp-Pro-Lys-Gln-Glu-Trp-Val-Gln-Arg-Tyr-Met-Lys-Asn-Leu-Asp-Ala-Lys-Gln-Lys-Lys-Ala-Ser-Pro-Arg-Ala-Arg-Ala-Val-Ala-Val-Lys-Gly-Pro-Val-Gln-Arg-Tyr-Pro-Gly-Asn-Gln-Thr-Thr-Cys