GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: ALX-0600 | Gattex® | GLP2-2G | Revestive®
teduglutide is an approved drug (FDA and EMA (2012))
Compound class:
Peptide
Comment: Teduglutide is a glucagon-like peptide-2 (GLP-2) analogue in which position 2 amino acid alanine is replaced by glycine, increasing the peptide's resistance to proteolytic cleavage by dipeptidyl peptidase-4 (DPP-4) [2]. The chemical structure shown here was generated using the SMILES from PubChem CID 16139605. The intestinotrophic effects of GLP-2 (e.g. promotion of intestinal growth, reduced epithelial cell apoptosis and inflammation) has led to the development of GLP-2 analogues like teduglutide for the treatment of GI disorders such as short bowel syndrome and inflammatory bowel diseases.
|
|
Peptide Sequence ![]() |
|
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD | |
H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH |
HELM Notation ![]() |
|
PEPTIDE1{H.G.D.G.S.F.S.D.E.M.N.T.I.L.D.N.L.A.A.R.D.F.I.N.W.L.I.Q.T.K.I.T.D}$$$$ |
Download 2D Structure ![]() |
|
Canonical SMILES | Download |
Isomeric SMILES | Download |
InChI standard identifier | Download |
InChI standard key | Download |
Molecular structure representations generated using Open Babel