GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
| 
                                                                Synonyms: ALX-0600 | Gattex® | GLP2-2G | Revestive®
                                 teduglutide is an approved drug (FDA and EMA (2012)) Compound class: 
                                                            Peptide
                                 
                                    
                                        Comment: Teduglutide is a glucagon-like peptide-2 (GLP-2) analogue in which position 2 amino acid alanine is replaced by glycine, increasing the peptide's resistance to proteolytic cleavage by dipeptidyl peptidase-4 (DPP-4) [2]. The chemical structure shown here was generated using the SMILES from PubChem CID 16139605. The intestinotrophic effects of GLP-2 (e.g. promotion of intestinal growth, reduced epithelial cell apoptosis and inflammation) has led to the development of GLP-2 analogues like teduglutide for the treatment of GI disorders such as short bowel syndrome and inflammatory bowel diseases.
                                    
                                 | 
 | |||||||||||||||||
| Peptide Sequence  | |
| HGDGSFSDEMNTILDNLAARDFINWLIQTKITD | |
| H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH | |
| HELM Notation  | |
| PEPTIDE1{H.G.D.G.S.F.S.D.E.M.N.T.I.L.D.N.L.A.A.R.D.F.I.N.W.L.I.Q.T.K.I.T.D}$$$$ | |
| Download 2D Structure  | |
| Canonical SMILES | Download | 
| Isomeric SMILES | Download | 
| InChI standard identifier | Download | 
| InChI standard key | Download | 
Molecular structure representations generated using Open Babel