GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

R-spondin-2   Click here for help

GtoPdb Ligand ID: 5540

Synonyms: cristin-2 | cysteine-rich and single thrombospondin domain-containing protein 2 | mCristin-2 | roof plate-specific spondin-2
Species: Mouse
Click here for help
Peptide Sequence Click here for help
NRWRRNKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDS
CFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLDETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPAKD
TIPCPTIAESRRCKMAMRHCPGGKRTPKAKEKRNKKKRRKLIERAQEQHSVFLATDRVNQ
Post-translational Modification
Predicted N-linked glycosylation of aspragine residue at position 137; predicted disulphide bond formation between cysteine residues at positions 122 and 164; 133 and 140, and 173 and 180