GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

VEGFA   Click here for help

GtoPdb Ligand ID: 5085

Synonyms: vascular endothelial growth factor A | vascular permeability factor (VPF) | VEGF-A
Comment: The active peptide is anti-parallel homodimer linked by disulphide bonds. VEGFA exists as four isoforms of 121, 165, 189 and 206 amino acids. The shortest variant contains the full VEGFR2 binding site but lacks domains that are involved in interactions with extracellular-matrix and co-receptors which are present in the longer isoforms [15,17].
A recombinant single-chain derivative of VEGFA121 (scVEGF) can be used experimentally as a fully functional peptide that binds and activates VEGFR2 in the same manner as endogenous VEGFA [1]. scVEGF can be labelled with a single fluorophore at its N-terminal, for use as a molecular probe [4].
Species: Human
Click here for help
Peptide Sequence Click here for help
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQI
MRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGP
CSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Selected 3D Structures
PDB Id: 1bj1
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Homodimer formed by interchain disulphide bonds between cysteine residues at positions 51 and 60; further disulphide bonds formed between cysteine residues at positions 26 and 68, 57 and 102, and 61 and 104. Lysine residues at positions 121, 123 and 126 are N6-acetyllysine. N-linked glycosylation of asparagine residue at position 75