From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

thymic stromal lymphopoietin   Click here for help

GtoPdb Ligand ID: 5083

Abbreviated name: TSLP
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: Thymic stromal lymphopoietin (TLSP), an IL-7 like cytokine, is the endogenous ligand for the TLSP receptor. TLSP/TLSPR signalling is pro-inflammatory.
Species: Human
Peptide Sequence Click here for help
YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAI
WCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 36 and 91