GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CD70   Click here for help

GtoPdb Ligand ID: 5079

Synonyms: CD27 ligand | Ki-24 | TNFSF7
Species: Human
Peptide Sequence Click here for help
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPA
LGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTP
LARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 63 and 170; disulphide bond formation between cysteine residues at positions 133 and 151