GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

Fas ligand   Click here for help

GtoPdb Ligand ID: 5078

Synonyms: apoptosis antigen ligand | CD95L
Immunopharmacology Ligand
Comment: The TNFSF6 precursor is also cleaved into a soluble form of the ligand.
Species: Human
Peptide Sequence Click here for help
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTG
LCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPL
EWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWA
RSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 184, 250 and 260; predicted disulphide bond formation between cysteine residues at positions 202 and 233